General Information
DRAVP ID DRAVPe00420
Peptide Name EK1V1
Sequence SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELK
Sequence Length 37
UniProt ID No entry found
Source Synthetic construct(derived from EK1)
Activity Information
Target Organism SARS-CoV-2,SARS-CoV,MERS-CoV,HCoV-NL63
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism A six-helical bundle structure is formed by two heptad repeat domains (HR1 and HR2) in S2, juxtaposing the viral and cellular membranes for fusion.The peptide derived from the HR2 sequence can competitively bind to the viral HR1 domain thus exerting antiviral activity.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00420
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Chol
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C202H329N45O65S
Absent amino acids CGHPRW
Common amino acids EL
Mass 4460.16
Pl 4.53
Basic residues 6
Acidic residues 10
Hydrophobic residues 13
Net charge -4
Boman Index -6858
Hydrophobicity -52.7
Aliphatic Index 115.95
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 82.78
Polar residues 6
Literature Information
Literature 1
Title SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses.
Pubmed ID 34344868
Reference Signal Transduct Target Ther. 2021 Aug 3;6(1):294.
Author Zhu Y, Yu D, Hu Y, Wu T, Chong H, He Y.