General Information
DRAVP ID DRAVPe00430
Peptide Name EKL0
Sequence SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVKW
Sequence Length 45
UniProt ID No entry found
Source Synthetic construct(derived from EK1)
Activity Information
Target Organism SARS-CoV-2
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism The 6-HB structure formed by HR1 and HR2 regions in the S2 subunit of HCoVs plays a key role during the viral membrane fusion process,peptides derived from the HR2 regions can competitively inhibit viral 6-HB formation, thereby preventing viral fusion and entry into host cells.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00430
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C256H392N54O79S
Absent amino acids CHPR
Common amino acids E
Mass 5522.3
Pl 4.44
Basic residues 6
Acidic residues 11
Hydrophobic residues 15
Net charge -5
Boman Index -7107
Hydrophobicity -54.89
Aliphatic Index 101.78
Half Life
Extinction Coefficient cystines 12950
Absorbance 280nm 294.32
Polar residues 11
Literature Information
Literature 1
Title A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases.
Pubmed ID 34367893
Reference Acta Pharm Sin B. 2021 Aug 2.
Author Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q.