General Information

General Information

DRAVP ID DRAVPe00432

Peptide Name EKL2

Sequence TFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYV

Sequence Length 36

UniProt ID No entry found

Source Synthetic construct(derived from EK1)

Activity Information

Target Organism SARS-CoV-2

Assay

Activity

[Ref.34367893]SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.526±0.049 μmol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50>5 μmol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=4.714±1.173 μmol/L),inhibition of cell-cell fusion(IC50=1.240±0.246 μmol/L).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity No cytotoxicity information found in the reference(s) presented

Binding Target membrane

Mechanism The 6-HB structure formed by HR1 and HR2 regions in the S2 subunit of HCoVs plays a key role during the viral membrane fusion process,peptides derived from the HR2 regions can competitively inhibit viral 6-HB formation, thereby preventing viral fusion and entry into host cells.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00432

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C206H315N41O65S

Absent amino acids CHNPQRW

Common amino acids E

Mass 4438.06

Pl 4.39

Basic residues 5

Acidic residues 10

Hydrophobic residues 11

Net charge -5

Boman Index -5743

Hydrophobicity -58.61

Aliphatic Index 97.5

Half Life

Mammalian:7.2 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 7450

Absorbance 280nm 212.86

Polar residues 9

Literature Information

Literature 1

Title A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases.

Pubmed ID 34367893

Reference Acta Pharm Sin B. 2021 Aug 2.

Author Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q.

DOI 10.1016/j.apsb.2021.07.026