General Information
DRAVP ID DRAVPe00434
Peptide Name EKL0C
Sequence SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVKWGSGC
Sequence Length 49
UniProt ID No entry found
Taxon ID None
Source Synthetic construct(derived from EK1)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not available
Activity Information
Target Organism SARS-CoV-2
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism The 6-HB structure formed by HR1 and HR2 regions in the S2 subunit of HCoVs plays a key role during the viral membrane fusion process,peptides derived from the HR2 regions can competitively inhibit viral 6-HB formation, thereby preventing viral fusion and entry into host cells.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00434
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Chol
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C266H408N58O84S2
Absent amino acids HPR
Common amino acids E
Mass 5826.62
Pl 4.44
Basic residues 6
Acidic residues 11
Hydrophobic residues 15
Net charge -5
Boman Index -7131
Hydrophobicity -48.57
Aliphatic Index 93.47
Half Life
Extinction Coefficient cystines 12950
Absorbance 280nm 269.79
Polar residues 15
Literature Information
Literature 1
Title A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases.
Pubmed ID 34367893
Reference Acta Pharm Sin B. 2021 Aug 2.
Author Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q.