General Information

General Information

DRAVP ID DRAVPe00434

Peptide Name EKL0C

Sequence SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVKWGSGC

Sequence Length 49

UniProt ID No entry found

Source Synthetic construct(derived from EK1)

Activity Information

Target Organism SARS-CoV-2

Assay

Activity

[Ref.34367893]SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=0.122±0.012 μmol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50=0.147±0.055 μmol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.162±0.022 μmol/L),inhibition of cell-cell fusion(IC50=0.021±0.003 μmol/L).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity No cytotoxicity information found in the reference(s) presented

Binding Target membrane

Mechanism The 6-HB structure formed by HR1 and HR2 regions in the S2 subunit of HCoVs plays a key role during the viral membrane fusion process,peptides derived from the HR2 regions can competitively inhibit viral 6-HB formation, thereby preventing viral fusion and entry into host cells.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00434

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Chol

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C266H408N58O84S2

Absent amino acids HPR

Common amino acids E

Mass 5826.62

Pl 4.44

Basic residues 6

Acidic residues 11

Hydrophobic residues 15

Net charge -5

Boman Index -7131

Hydrophobicity -48.57

Aliphatic Index 93.47

Half Life

Mammalian:1.9 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 12950

Absorbance 280nm 269.79

Polar residues 15

Literature Information

Literature 1

Title A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases.

Pubmed ID 34367893

Reference Acta Pharm Sin B. 2021 Aug 2.

Author Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q.

DOI 10.1016/j.apsb.2021.07.026