General Information


DRAVP ID  DRAVPe00439

Peptide Name   EKL2P

Sequence  TFLDLEYEMKKLEEAIKKLEESYIDLKELGTYEYYVGSGK

Sequence Length  40

UniProt ID  No entry found

Source  Synthetic construct(derived from EK1)



Activity Information


Target Organism  SARS-CoV-2

Assay 

Activity 

  • [Ref.34367893]SARS-CoV-2:Inhibition of Pseudovirus(PsV) infection in Huh-7 cells(IC50=1.129±0.166 μmol/L),Inhibition of Pseudovirus(PsV) infection in 293T/ACE2 cells(IC50=0.973±0.254 μmol/L),Inhibition of Pseudovirus(PsV) infection in Caco-2 cells(IC50=0.304±0.051 μmol/L),inhibition of cell-cell fusion(IC50=0.183±0.028 μmol/L).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  membrane

Mechanism  The 6-HB structure formed by HR1 and HR2 regions in the S2 subunit of HCoVs plays a key role during the viral membrane fusion process,peptides derived from the HR2 regions can competitively inhibit viral 6-HB formation, thereby preventing viral fusion and entry into host cells.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00439

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Palm

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C219H338N46O70S

Absent amino acids  CHNPQRW

Common amino acids  E

Mass  4767.42

Pl  4.57

Basic residues  6

Acidic residues  10

Hydrophobic residues  11

Net charge  -4

Boman Index  -6450

Hydrophobicity  -66.5

Aliphatic Index  87.75

Half Life 

  •     Mammalian:7.2 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  7450

Absorbance 280nm  191.03

Polar residues  12



Literature Information


Literature 1

Title   A highly potent and stable pan-coronavirus fusion inhibitor as a candidate prophylactic and therapeutic for COVID-19 and other coronavirus diseases.

Pubmed ID   34367893

Reference   Acta Pharm Sin B. 2021 Aug 2.

Author   Zhou J, Xu W, Liu Z, Wang C, Xia S, Lan Q, Cai Y, Su S, Pu J, Xing L, Xie Y, Lu L, Jiang S, Wang Q.

DOI   10.1016/j.apsb.2021.07.026