General Information

General Information

DRAVP ID DRAVPe00442

Peptide Name EK1-C16

Sequence SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG

Sequence Length 41

UniProt ID No entry found

Taxon ID None

Source Synthetic construct(derived from EK1)

Validation Experimentally Validated

Origin Information

Gene Name/ID Not Available

GenBank Not Available

Amino Acid position Not Available

Domain Accession ID Not Available

Nucleotide sequence ID Not Available

Molecular Type Not Available

Chromosomal Position Not Available

Activity Information

Target Organism SARS-CoV-2,SARS-CoV,MERS-CoV,HCoV-OC43

Assay pseudovirus inhibition assay

Activity

[Ref.35336956]SARS-CoV-2 WT:inhibition of pseudovirus (PsV) infection in Caco2 cells(IC50=0.48 μM);
SARS-CoV-2 Alpha:inhibition of pseudovirus (PsV) infection(IC50=0.19 μM);
SARS-CoV-2 Beta:inhibition of pseudovirus (PsV) infection(IC50=0.43 μM);
SARS-CoV-2 Gamma:inhibition of pseudovirus (PsV) infection(IC50=0.26 μM);
SARS-CoV-2 Delta:inhibition of pseudovirus (PsV) infection(IC50=0.11 μM);
SARS-CoV-2 Omicron:inhibition of pseudovirus (PsV) infection(IC50=0.23 μM);inhibition of authentic infection in Vero-E6-TMPRSS-2 cells(IC50=0.75 μM);
SARS-CoV:inhibition of pseudovirus (PsV) infection(IC50=0.17 μM);
SARSr-CoV WIV1:inhibition of pseudovirus (PsV) infection(IC50=0.15 μM);
SARSr-CoV Rs3367:inhibition of pseudovirus (PsV) infection(IC50=0.3 μM);
MERS-CoV:inhibition of pseudovirus (PsV) infection in Caco2 cells(IC50=0.10 μM);inhibition of cell-cell fusion(IC50=0.012 μM);
HCoV-OC43:inhibition of authentic infection in RD cells(IC50=0.07 μM);inhibition of cell-cell fusion(IC50=0.01 μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.35336956]showed no significant cytotoxicity against RD cells at the concentration of 5 μM.

Binding Target membrane

Mechanism The 6-HB structure formed by HR1 and HR2 regions in the S2 subunit of HCoVs plays a key role during the viral membrane fusion process,peptides derived from the HR2 regions can competitively inhibit viral 6-HB formation, thereby preventing viral fusion and entry into host cells.

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification PEG4-C16(palmitic acid)

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C208H336N48O71S

Absent amino acids CHPRW

Common amino acids EL

Mass 4677.29

Pl 4.36

Basic residues 5

Acidic residues 10

Hydrophobic residues 13

Net charge -5

Boman Index -6701

Hydrophobicity -44.88

Aliphatic Index 104.63

Half Life

Mammalian:1.9 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 2980

Absorbance 280nm 74.5

Polar residues 11

Literature Information

Literature 1

Title A Palmitic Acid-Conjugated, Peptide-Based pan-CoV Fusion Inhibitor Potently Inhibits Infection of SARS-CoV-2 Omicron and Other Variants of Concern.

Pubmed ID 35336956

Reference Viruses. 2022 Mar 6;14(3):549.

Author Lan Q, Chan JF, Xu W, Wang L, Jiao F, Zhang G, Pu J, Zhou J, Xia S, Lu L, Yuen KY, Jiang S, Wang Q.

DOI 10.3390/v14030549