General Information
DRAVP ID DRAVPe00442
Peptide Name EK1-C16
Sequence SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG
Sequence Length 41
UniProt ID No entry found
Taxon ID None
Source Synthetic construct(derived from EK1)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism SARS-CoV-2,SARS-CoV,MERS-CoV,HCoV-OC43
Assay pseudovirus inhibition assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The 6-HB structure formed by HR1 and HR2 regions in the S2 subunit of HCoVs plays a key role during the viral membrane fusion process,peptides derived from the HR2 regions can competitively inhibit viral 6-HB formation, thereby preventing viral fusion and entry into host cells.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification PEG4-C16(palmitic acid)
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C208H336N48O71S
Absent amino acids CHPRW
Common amino acids EL
Mass 4677.29
Pl 4.36
Basic residues 5
Acidic residues 10
Hydrophobic residues 13
Net charge -5
Boman Index -6701
Hydrophobicity -44.88
Aliphatic Index 104.63
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 74.5
Polar residues 11
Literature Information
Literature 1
Title A Palmitic Acid-Conjugated, Peptide-Based pan-CoV Fusion Inhibitor Potently Inhibits Infection of SARS-CoV-2 Omicron and Other Variants of Concern.
Pubmed ID 35336956
Reference Viruses. 2022 Mar 6;14(3):549.
Author Lan Q, Chan JF, Xu W, Wang L, Jiao F, Zhang G, Pu J, Zhou J, Xia S, Lu L, Yuen KY, Jiang S, Wang Q.