General Information

General Information

DRAVP ID DRAVPe00455

Peptide Name Brevinin-2GHk(BR2GK)

Sequence GFSSLFKAGAKYLLKQVGKAGAQQLACKAANNC

Sequence Length 33

UniProt ID A0A6G6CZ26

Source Fejervarya limnocharis

Activity Information

Target Organism ZIKV

Assay

Activity

[Ref.34960651]Zika Virus: inhibition of infection of Zika virus in Vero cells(IC50=3.408 ± 0.738 μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.34960651]exhibited no significant toxicity to Vero, Hela, and Huh7 cells in the concentration range 0-20 µM.

Binding Target membrane

Mechanism BR2GK directly inactivated ZIKV by disrupting the integrity of the envelope and may also penetrate the host cell membrane to inhibit the middle stage of ZIKV infection.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00455

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C150H245N43O42S2

Absent amino acids DEHIMPRTW

Common amino acids A

Mass 3386.98

Pl 9.79

Basic residues 5

Acidic residues 0

Hydrophobic residues 14

Net charge 5

Boman Index -1592

Hydrophobicity 3.33

Aliphatic Index 77.27

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 1615

Absorbance 280nm 50.47

Polar residues 11

Literature Information

Literature 1

Title Brevinin-2GHk, a Peptide Derived from the Skin of Fejervarya limnocharis, Inhibits Zika Virus Infection by Disrupting Viral Integrity.

Pubmed ID 34960651

Reference Viruses. 2021 Nov 28;13(12):2382.

Author Xiong W, Li J, Feng Y, Chai J, Wu J, Hu Y, Tian M, Lu W, Xu X, Zou M.

DOI 10.3390/v13122382