DRAVP ID  DRAVPe00455

Peptide Name   Brevinin-2GHk(BR2GK)

Sequence  GFSSLFKAGAKYLLKQVGKAGAQQLACKAANNC

Sequence Length  33

UniProt ID  A0A6G6CZ26 

Taxon ID  None

Source  Fejervarya limnocharis

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  ZIKV

Assay 

Activity 

• [Ref.34960651]Zika Virus: inhibition of infection of Zika virus in Vero cells(IC50=3.408 ± 0.738 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• [Ref.34960651]exhibited no significant toxicity to Vero, Hela, and Huh7 cells in the concentration range 0-20 µM.

Binding Target  membrane

Mechanism  BR2GK directly inactivated ZIKV by disrupting the integrity of the envelope and may also penetrate the host cell membrane to inhibit the middle stage of ZIKV infection.

PDB ID  None

Predicted Structure Download  DRAVPe00455

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L

Literature 1

Title   Brevinin-2GHk, a Peptide Derived from the Skin of Fejervarya limnocharis, Inhibits Zika Virus Infection by Disrupting Viral Integrity.

Pubmed ID   34960651

Reference   Viruses. 2021 Nov 28;13(12):2382. 

Author   Xiong W, Li J, Feng Y, Chai J, Wu J, Hu Y, Tian M, Lu W, Xu X, Zou M.

DOI   10.3390/v13122382