General Information
DRAVP ID DRAVPe00459
Peptide Name CPXV012
Sequence QEGISRFKICPYHWYKQHMSLLFRRYYHKLDSII
Sequence Length 34
UniProt ID No entry found
Taxon ID None
Source Synthetic construct(derived from the cowpox virus protein)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HSV,HBV,HIV,RVFV
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target envelope(phosphatidylserine)
Mechanism Within virus-infected cells, this protein helps to evade the immune system by inhibiting the transporter associated with antigen processing (TAP), thereby interfering with MHC I-dependent antigen presentation. And the peptide is the segment of the CPXV012 protein responsible for blocking TAP.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00459
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C204H303N55O48S2
Absent amino acids ANTV
Common amino acids IY
Mass 4358.11
Pl 9.65
Basic residues 9
Acidic residues 2
Hydrophobic residues 10
Net charge 7
Boman Index -6546
Hydrophobicity -58.53
Aliphatic Index 80.29
Half Life
Extinction Coefficient cystines 11460
Absorbance 280nm 347.27
Polar residues 9
Literature Information
Literature 1
Title A Broad-Spectrum Antiviral Peptide Blocks Infection of Viruses by Binding to Phosphatidylserine in the Viral Envelope.
Pubmed ID 32872420
Reference Cells. 2020 Aug 29;9(9):1989.
Author Luteijn RD, Praest P, Thiele F, Sadasivam SM, Singethan K, Drijfhout JW, Bach C, de Boer SM, Lebbink RJ, Tao S, Helfer M, Bach NC, Protzer U, Costa AI, Killian JA, Drexler I, Wiertz EJHJ.