General Information

General Information

DRAVP ID DRAVPe00459

Peptide Name CPXV012

Sequence QEGISRFKICPYHWYKQHMSLLFRRYYHKLDSII

Sequence Length 34

UniProt ID No entry found

Source Synthetic construct(derived from the cowpox virus protein)

Activity Information

Target Organism HSV,HBV,HIV,RVFV

Assay

Activity

[Ref.32872420]Herpes simplex virus-1(HSV-1):inhibition of HSV-1 infection in MelJuSo(MJS) cells(75.9 ± 5.7% inhibition at 150 µg/mL);
Hepatitis B virus(HBV): decrease of HBeAg and viral DNA infected with HBV-1 in HepRG cells(84.0 ± 3.0% of HBeAg and 73.6 ± 2.3% of viral DNA at 100 µg/mL);
HIV-1:inhibition of virus infection in LC5-RIC reporter cells(82.7 ± 4.9% inhibition at 100 µg/mL);inhibition of virus replication in LC5-RIC reporter cells(62.2 ± 2.4% inhibition at 100 µg/mL);
Rift Valley fever virus(RVFV): inhibition of virus infection in MJS cells(65.5 ± 2.3% inhibition at 160 µg/mL).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.32872420]Did not observe any decrease in live cells against Vero and Huh7.5 cells up to 200 µg/mL.

Binding Target envelope(phosphatidylserine)

Mechanism Within virus-infected cells, this protein helps to evade the immune system by inhibiting the transporter associated with antigen processing (TAP), thereby interfering with MHC I-dependent antigen presentation. And the peptide is the segment of the CPXV012 protein responsible for blocking TAP.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00459

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C204H303N55O48S2

Absent amino acids ANTV

Common amino acids IY

Mass 4358.11

Pl 9.65

Basic residues 9

Acidic residues 2

Hydrophobic residues 10

Net charge 7

Boman Index -6546

Hydrophobicity -58.53

Aliphatic Index 80.29

Half Life

Mammalian:0.8 hour
Yeast:10 min
E.coli:>10 hour

Extinction Coefficient cystines 11460

Absorbance 280nm 347.27

Polar residues 9

Literature Information

Literature 1

Title A Broad-Spectrum Antiviral Peptide Blocks Infection of Viruses by Binding to Phosphatidylserine in the Viral Envelope.

Pubmed ID 32872420

Reference Cells. 2020 Aug 29;9(9):1989.

Author Luteijn RD, Praest P, Thiele F, Sadasivam SM, Singethan K, Drijfhout JW, Bach C, de Boer SM, Lebbink RJ, Tao S, Helfer M, Bach NC, Protzer U, Costa AI, Killian JA, Drexler I, Wiertz EJHJ.

DOI 10.3390/cells9091989