General Information

General Information

DRAVP ID DRAVPe00470

Peptide Name EK1P4HC

Sequence SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG

Sequence Length 41

UniProt ID No entry found

Source Synthetic construct

Activity Information

Target Organism SARS-CoV-2,SARS-CoV,HCoV-229E,HCoV-OC43,MERS-CoV

Assay pseudovirus inhibition assay

Activity

[Ref.34769299]SARS-CoV-2:inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.8 μM);
SARS-CoV-2 B.1.1.7 (Alpha):inhibition of Pseudoviruse infection in Caco2 cells(IC50=2.28 μM);
SARS-CoV-2 B.1.351 (Beta):inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.62 μM);
SARS-CoV-2 P.1 (Gamma):inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.48 μM);
SARS-CoV-2 B.1.617.2 (Delta):inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.11 μM);
HCoV-229E(Authentic):inhibition of infection in Caco2 cells(IC50=0.48 μM);
HCoV-OC43(Authentic):inhibition of infection in Caco2 cells(IC50=0.41 μM);
SARS-CoV:inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.35 μM);
MERS-CoV:inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.10 μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.34769299]no apparent cytotoxicity against Caco-2 cells at concentrations of up to 20 μM.

Binding Target mambrane

Mechanism The peptide targets two different sites when mediating virus–cell fusion,which are blocking viral 6-HB formation and reducing the membrane cholesterol level.

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification PEG4-25-HC

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C208H336N48O71S

Absent amino acids CHPRW

Common amino acids EL

Mass 4677.29

Pl 4.36

Basic residues 5

Acidic residues 10

Hydrophobic residues 13

Net charge -5

Boman Index -6701

Hydrophobicity -44.88

Aliphatic Index 104.63

Half Life

Mammalian:1.9 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 2980

Absorbance 280nm 74.5

Polar residues 11

Literature Information

Literature 1

Title 25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses.

Pubmed ID 34769299

Reference Int J Mol Sci. 2021 Nov 1;22(21):11869.

Author Lan Q, Wang C, Zhou J, Wang L, Jiao F, Zhang Y, Cai Y, Lu L, Xia S, Jiang S.

DOI 10.3390/ijms222111869