General Information
DRAVP ID DRAVPe00470
Peptide Name EK1P4HC
Sequence SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG
Sequence Length 41
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism SARS-CoV-2,SARS-CoV,HCoV-229E,HCoV-OC43,MERS-CoV
Assay pseudovirus inhibition assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target mambrane
Mechanism The peptide targets two different sites when mediating virus–cell fusion,which are blocking viral 6-HB formation and reducing the membrane cholesterol level.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification PEG4-25-HC
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C208H336N48O71S
Absent amino acids CHPRW
Common amino acids EL
Mass 4677.29
Pl 4.36
Basic residues 5
Acidic residues 10
Hydrophobic residues 13
Net charge -5
Boman Index -6701
Hydrophobicity -44.88
Aliphatic Index 104.63
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 74.5
Polar residues 11
Literature Information
Literature 1
Title 25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses.
Pubmed ID 34769299
Reference Int J Mol Sci. 2021 Nov 1;22(21):11869.
Author Lan Q, Wang C, Zhou J, Wang L, Jiao F, Zhang Y, Cai Y, Lu L, Xia S, Jiang S.