General Information

General Information

DRAVP ID DRAVPe00470

Peptide Name EK1P4HC

Sequence SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG

Sequence Length 41

UniProt ID No entry found

Taxon ID None

Source Synthetic construct

Validation Experimentally Validated

Origin Information

Gene Name/ID Not Available

GenBank Not Available

Amino Acid position Not Available

Domain Accession ID Not Available

Nucleotide sequence ID Not Available

Molecular Type Not Available

Chromosomal Position Not Available

Activity Information

Target Organism SARS-CoV-2,SARS-CoV,HCoV-229E,HCoV-OC43,MERS-CoV

Assay pseudovirus inhibition assay

Activity

[Ref.34769299]SARS-CoV-2:inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.8 μM);
SARS-CoV-2 B.1.1.7 (Alpha):inhibition of Pseudoviruse infection in Caco2 cells(IC50=2.28 μM);
SARS-CoV-2 B.1.351 (Beta):inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.62 μM);
SARS-CoV-2 P.1 (Gamma):inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.48 μM);
SARS-CoV-2 B.1.617.2 (Delta):inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.11 μM);
HCoV-229E(Authentic):inhibition of infection in Caco2 cells(IC50=0.48 μM);
HCoV-OC43(Authentic):inhibition of infection in Caco2 cells(IC50=0.41 μM);
SARS-CoV:inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.35 μM);
MERS-CoV:inhibition of Pseudoviruse infection in Caco2 cells(IC50=0.10 μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.34769299]no apparent cytotoxicity against Caco-2 cells at concentrations of up to 20 μM.

Binding Target mambrane

Mechanism The peptide targets two different sites when mediating virus–cell fusion,which are blocking viral 6-HB formation and reducing the membrane cholesterol level.

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification PEG4-25-HC

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C208H336N48O71S

Absent amino acids CHPRW

Common amino acids EL

Mass 4677.29

Pl 4.36

Basic residues 5

Acidic residues 10

Hydrophobic residues 13

Net charge -5

Boman Index -6701

Hydrophobicity -44.88

Aliphatic Index 104.63

Half Life

Mammalian:1.9 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 2980

Absorbance 280nm 74.5

Polar residues 11

Literature Information

Literature 1

Title 25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses.

Pubmed ID 34769299

Reference Int J Mol Sci. 2021 Nov 1;22(21):11869.

Author Lan Q, Wang C, Zhou J, Wang L, Jiao F, Zhang Y, Cai Y, Lu L, Xia S, Jiang S.

DOI 10.3390/ijms222111869