General Information


DRAVP ID  DRAVPe00473

Peptide Name   EK1P24HC

Sequence  SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG

Sequence Length  41

UniProt ID  No entry found

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not available



Activity Information


Target Organism  SARS-CoV-2

Assay  pseudovirus inhibition assay

Activity 

  • [Ref.34769299]SARS-CoV-2:inhibition of Pseudoviruse infection in Caco2 cells(IC50=10.3 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.34769299]no apparent cytotoxicity against Caco-2 cells at concentrations of up to 20 μM.

Binding Target  membrane

Mechanism  The peptide targets two different sites when mediating virus–cell fusion,which are blocking viral 6-HB formation and reducing the membrane cholesterol level.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  PEG24-25-HC

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C208H336N48O71S

Absent amino acids  CHPRW

Common amino acids  EL

Mass  4677.29

Pl  4.36

Basic residues  5

Acidic residues  10

Hydrophobic residues  13

Net charge  -5

Boman Index  -6701

Hydrophobicity  -44.88

Aliphatic Index  104.63

Half Life 

  •     Mammalian:1.9 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  2980

Absorbance 280nm  74.5

Polar residues  11



Literature Information


Literature 1

Title   25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses.

Pubmed ID   34769299

Reference   Int J Mol Sci. 2021 Nov 1;22(21):11869.

Author   Lan Q, Wang C, Zhou J, Wang L, Jiao F, Zhang Y, Cai Y, Lu L, Xia S, Jiang S.

DOI   10.3390/ijms222111869