General Information
DRAVP ID DRAVPe00480
Peptide Name AHB1
Sequence DEDLEELERLYRKAEEVAKEAKDASRRGDDERAKEQMERAMRLFDQVFELAQELQEKQTDGNRQKATHLDKAVKEAADELYQRVR
Sequence Length 85
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not available
Activity Information
Target Organism SARS-CoV-2
Assay neutralization assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target spike protein
Mechanism The peptide is a high-affinity protein minibinder to the SARS-CoV-2 spike receptor binding domain (RBD) that compete with ACE2 binding.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00480
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C426H695N133O147S2
Absent amino acids CIPW
Common amino acids E
Mass 10096.13
Pl 4.9
Basic residues 19
Acidic residues 24
Hydrophobic residues 25
Net charge -5
Boman Index -34516
Hydrophobicity -141.88
Aliphatic Index 63.29
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 35.48
Polar residues 8
Literature Information
Literature 1
Title De novo design of picomolar SARS-CoV-2 miniprotein inhibitors.
Pubmed ID 32907861
Reference Science. 2020 Oct 23;370(6515):426-431.
Author Cao L, Goreshnik I, Coventry B, Case JB, Miller L, Kozodoy L, Chen RE, Carter L, Walls AC, Park YJ, Strauch EM, Stewart L, Diamond MS, Veesler D, Baker D.