General Information


DRAVP ID  DRAVPe00480

Peptide Name   AHB1

Sequence  DEDLEELERLYRKAEEVAKEAKDASRRGDDERAKEQMERAMRLFDQVFELAQELQEKQTDGNRQKATHLDKAVKEAADELYQRVR

Sequence Length  85

UniProt ID  No entry found

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not available



Activity Information


Target Organism  SARS-CoV-2

Assay  neutralization assay

Activity 

  • [Ref.32907861]SARS-CoV-2:Inhibition of infection in Vero E6 cells(IC50=35 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  spike protein

Mechanism  The peptide is a high-affinity protein minibinder to the SARS-CoV-2 spike receptor binding domain (RBD) that compete with ACE2 binding.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00480

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C426H695N133O147S2

Absent amino acids  CIPW

Common amino acids  E

Mass  10096.13

Pl  4.9

Basic residues  19

Acidic residues  24

Hydrophobic residues  25

Net charge  -5

Boman Index  -34516

Hydrophobicity  -141.88

Aliphatic Index  63.29

Half Life 

  •     Mammalian:1.1 hour
  •     Yeast:3 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  2980

Absorbance 280nm  35.48

Polar residues  8



Literature Information


Literature 1

Title   De novo design of picomolar SARS-CoV-2 miniprotein inhibitors.

Pubmed ID   32907861

Reference   Science. 2020 Oct 23;370(6515):426-431.

Author   Cao L, Goreshnik I, Coventry B, Case JB, Miller L, Kozodoy L, Chen RE, Carter L, Walls AC, Park YJ, Strauch EM, Stewart L, Diamond MS, Veesler D, Baker D.

DOI   10.1126/science.abd9909