To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00482
Peptide Name LCB1
Sequence DKEWILQKIYEIMRLLDELGHAEASMRVSDLIYEFMKKGDERLLEEAERLLEEVER
Sequence Length 56
UniProt ID No entry found
Source Synthetic construct
Activity Information
Target Organism SARS-CoV-2
Assay neutralization assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target spike protein
Mechanism The peptide is a high-affinity protein minibinder to the SARS-CoV-2 spike receptor binding domain (RBD) that compete with ACE2 binding.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00482
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C301H485N79O94S3
Absent amino acids CNPT
Common amino acids E
Mass 6810.81
Pl 4.59
Basic residues 10
Acidic residues 16
Hydrophobic residues 20
Net charge -6
Boman Index -13897
Hydrophobicity -57.5
Aliphatic Index 106.25
Half Life
Extinction Coefficient cystines 8480
Absorbance 280nm 154.18
Polar residues 6
Literature Information
Literature 1
Title De novo design of picomolar SARS-CoV-2 miniprotein inhibitors.
Pubmed ID 32907861
Reference Science. 2020 Oct 23;370(6515):426-431.
Author Cao L, Goreshnik I, Coventry B, Case JB, Miller L, Kozodoy L, Chen RE, Carter L, Walls AC, Park YJ, Strauch EM, Stewart L, Diamond MS, Veesler D, Baker D.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.