To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00517
Peptide Name M0
Sequence TTLLDLTYEMLSLQQVVKALNESYIDLKEL
Sequence Length 30
UniProt ID No entry found
Source Synthetic construct
Activity Information
Target Organism MERS-CoV
Assay ELISA
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism The peptide inhibits HIV fusion by binding to the hydrophobic grooves on the N-terminal heptad repeat (NHR) trimer and blocking six-helix-bundle (6-HB) formation.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00517
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C157H259N35O51S
Absent amino acids CFGHPRW
Common amino acids L
Mass 3485.05
Pl 4.18
Basic residues 2
Acidic residues 5
Hydrophobic residues 12
Net charge -3
Boman Index -2496
Hydrophobicity 16.33
Aliphatic Index 139.67
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 102.76
Polar residues 8
Literature Information
Literature 1
Title Creating an Artificial Tail Anchor as a Novel Strategy To Enhance the Potency of Peptide-Based HIV Fusion Inhibitors.
Pubmed ID 27795416
Reference J Virol. 2016 Dec 16;91(1):e01445-16.
Author Su S, Zhu Y, Ye S, Qi Q, Xia S, Ma Z, Yu F, Wang Q, Zhang R, Jiang S, Lu L.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.