General Information
DRAVP ID DRAVPe00518
Peptide Name M1
Sequence EANTTLLDLTYEMLSLQQVVKALNESYIDLKEL
Sequence Length 33
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not available
Activity Information
Target Organism MERS-CoV
Assay ELISA
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism The peptide inhibits HIV fusion by binding to the hydrophobic grooves on the N-terminal heptad repeat (NHR) trimer and blocking six-helix-bundle (6-HB) formation.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00518
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C169H277N39O57S
Absent amino acids CFGHPRW
Common amino acids L
Mass 3799.35
Pl 4.08
Basic residues 2
Acidic residues 6
Hydrophobic residues 13
Net charge -4
Boman Index -3660
Hydrophobicity -0.91
Aliphatic Index 130
                            Half Life  
   								
Extinction Coefficient cystines 2980
Absorbance 280nm 93.13
Polar residues 9
Literature Information
Literature 1
Title Creating an Artificial Tail Anchor as a Novel Strategy To Enhance the Potency of Peptide-Based HIV Fusion Inhibitors.
Pubmed ID 27795416
Reference J Virol. 2016 Dec 16;91(1):e01445-16.
Author Su S, Zhu Y, Ye S, Qi Q, Xia S, Ma Z, Yu F, Wang Q, Zhang R, Jiang S, Lu L.