General Information

General Information

DRAVP ID DRAVPe00519

Peptide Name C34

Sequence WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL

Sequence Length 34

UniProt ID No entry found

Source Synthetic construct

Other Link DRAVPa0875

Activity Information

Target Organism HIV

Assay MAGI assay

Activity

[Ref.19073606]HIV-1 NL4-3:inhibition of virus replication in HeLa cells(EC50=7.3± 2.5 nM);
HIV-1(NL4-3V38A):inhibition of virus replication in HeLa cells(EC50=15± 2.3 nM);
HIV-1(NL4-3N43D):inhibition of virus replication in HeLa cells(EC50=23 ± 5.0 nM);
HIV-1(NL4-3N43D/S138A):inhibition of virus replication in HeLa cells(EC50=19 ±4.7 nM).
[Ref.27795416]HIV-1 IIIB:inhibition of virus infection in MT-2 cells(IC50=7.2±0.2 nM); inhibition of peptide against cell-cell fusion between H9/HIV-1 IIIB cells and MT-2 cells(IC50=18.8± 1.6 nM);
HIV-1 Bal:inhibition of virus infection in MT-2 cells(IC50=7.6±0.2 nM);

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target membrane

Mechanism The peptide prevents interactions between the C-HR and the N-terminal HR (N-HR) of gp41, thus interfering with conformational changes that are required for viral fusion.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00519

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C184H280N50O64S

Absent amino acids ACFGPV

Common amino acids E

Mass 4248.6

Pl 4.21

Basic residues 3

Acidic residues 8

Hydrophobic residues 9

Net charge -5

Boman Index -10170

Hydrophobicity -127.06

Aliphatic Index 80.29

Half Life

Mammalian:2.8 hour
Yeast:3 min
E.coli:2 min

Extinction Coefficient cystines 12490

Absorbance 280nm 378.48

Polar residues 9

Literature Information

Literature 1

Title Design of peptide-based inhibitors for human immunodeficiency virus type 1 strains resistant to T-20.

Pubmed ID 19073606

Reference J Biol Chem. 2009 Feb 20;284(8):4914-20.

Author Izumi K, Kodama E, Shimura K, Sakagami Y, Watanabe K, Ito S, Watabe T, Terakawa Y, Nishikawa H, Sarafianos SG, Kitaura K, Oishi S, Fujii N, Matsuoka M.

DOI 10.1074/jbc.M807169200

Literature 2

Title Creating an Artificial Tail Anchor as a Novel Strategy To Enhance the Potency of Peptide-Based HIV Fusion Inhibitors.

Pubmed ID 27795416

Reference J Virol. 2016 Dec 16;91(1):e01445-16.

Author Su S, Zhu Y, Ye S, Qi Q, Xia S, Ma Z, Yu F, Wang Q, Zhang R, Jiang S, Lu L.

DOI 10.1128/JVI.01445-16