General Information
DRAVP ID DRAVPe00519
Peptide Name C34
Sequence WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
Sequence Length 34
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Other Link DRAVPa0875
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not available
Activity Information
Target Organism HIV
Assay MAGI assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The peptide prevents interactions between the C-HR and the N-terminal HR (N-HR) of gp41, thus interfering with conformational changes that are required for viral fusion.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00519
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C184H280N50O64S
Absent amino acids ACFGPV
Common amino acids E
Mass 4248.6
Pl 4.21
Basic residues 3
Acidic residues 8
Hydrophobic residues 9
Net charge -5
Boman Index -10170
Hydrophobicity -127.06
Aliphatic Index 80.29
Half Life
Extinction Coefficient cystines 12490
Absorbance 280nm 378.48
Polar residues 9
Literature Information
Literature 1
Title Design of peptide-based inhibitors for human immunodeficiency virus type 1 strains resistant to T-20.
Pubmed ID 19073606
Reference J Biol Chem. 2009 Feb 20;284(8):4914-20.
Author Izumi K, Kodama E, Shimura K, Sakagami Y, Watanabe K, Ito S, Watabe T, Terakawa Y, Nishikawa H, Sarafianos SG, Kitaura K, Oishi S, Fujii N, Matsuoka M.
Literature 2
Title Creating an Artificial Tail Anchor as a Novel Strategy To Enhance the Potency of Peptide-Based HIV Fusion Inhibitors.
Pubmed ID 27795416
Reference J Virol. 2016 Dec 16;91(1):e01445-16.
Author Su S, Zhu Y, Ye S, Qi Q, Xia S, Ma Z, Yu F, Wang Q, Zhang R, Jiang S, Lu L.