General Information

General Information

DRAVP ID DRAVPe00599

Peptide Name MT-SC29EK

Sequence MTWEEWDKKIEEYTKKIEELIKKSEEQQKKN

Sequence Length 31

UniProt ID Q5DP94

Source Synthetic construct

Activity Information

Target Organism HIV

Assay dual split-protein (DSP)-based cell-cell fusion assay,luciferase assay

Activity

[Ref.31277353]HIV-1 NL4-3:inhibition of pseudovirus entry in TZM-bl cells(IC50=0.9±0.2 nM);
HIV-1 HXB2:inhibition of cell-cell fusion in TZM-bl cells(IC50=1.1±0.2 nM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target membrane

Mechanism The peptide inhibits HIV fusion by binding to the hydrophobic grooves on the N-terminal heptad repeat (NHR) trimer and blocking six-helix-bundle (6-HB) formation.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00599

Linear/Cyclic Linear

N-terminal Modification Acetylation

C-terminal Modification Amidation

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C177H282N44O57S

Absent amino acids ACFGHPRV

Common amino acids EK

Mass 3970.51

Pl 5.32

Basic residues 8

Acidic residues 9

Hydrophobic residues 6

Net charge -1

Boman Index -10731

Hydrophobicity -191.29

Aliphatic Index 50.32

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 12490

Absorbance 280nm 416.33

Polar residues 5

Literature Information

Literature 1

Title Conserved Residue Asn-145 in the C-Terminal Heptad Repeat Region of HIV-1 gp41 is Critical for Viral Fusion and Regulates the Antiviral Activity of Fusion Inhibitors.

Pubmed ID 31277353

Reference Viruses. 2019 Jul 3;11(7):609.

Author Geng X, Liu Z, Yu D, Qin B, Zhu Y, Cui S, Chong H, He Y.

DOI 10.3390/v11070609