DRAVP ID  DRAVPe00613

Peptide Name   T20v1(T20 [H6R; S7E; L8,26I; I9L; E10V; Q13,21R; N14I; L24R; E25D])

Sequence  YTSLIREILVESRIQQEKNERELRDIDKWASLWNWF

Sequence Length  36

UniProt ID  P04578 

Source  Synthetic construct(derived from T20)

Target Organism  HIV

Assay  neutralization assay

Activity 

• [Ref.31228294]HIV-1 N43:inhibition of virus infection in U87 cells(IC50=0.06 µg/ml);
• HIV-1 JRCSF:inhibition of virus infection in U87 cells(IC50=0.10 µg/ml);
• HIV-1 94UG103:inhibition of pseudovirus infection in U87 cells(IC50=0.06 µg/ml);
• HIV-1 92BR020:inhibition of pseudovirus infection in U87 cells(IC50=0.17 µg/ml);
• HIV-1 IAVI C22:inhibition of pseudovirus infection in U87 cells(IC50=0.12 µg/ml);
• HIV-1 92HT021:inhibition of pseudovirus infection in U87 cells(IC50=0.06 µg/ml);
• HIV-1 JRCSF-GIA:inhibition of pseudovirus infection in U87 cells(IC50=0.29 µg/ml).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  membrane

Mechanism  The peptide acts by binding to the heptad repeat 1 (HR1) region of gp41 and preventing the interaction of the HR1 and HR2 domains, which is required for virus–cell fusion.(By similar)

PDB ID  None

Predicted Structure Download  DRAVPe00613

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L

Literature 1

Title   Optimization of peptidic HIV-1 fusion inhibitor T20 by phage display.

Pubmed ID   31228294

Reference   Protein Sci. 2019 Aug;28(8):1501-1512.

Author   Chen G, Cook JD, Ye W, Lee JE, Sidhu SS.

DOI   10.1002/pro.3669