General Information
DRAVP ID DRAVPe00615
Peptide Name T20v3(T20 [I5L, H6R, L8I; S12G; Q13R; E22A])
Sequence YTSLLRSIIEEGRNQQEKNEQALLELDKWASLWNWF
Sequence Length 36
UniProt ID P04578
Taxon ID None
Source Synthetic construct(derived from T20)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV
Assay neutralization assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The peptide acts by binding to the heptad repeat 1 (HR1) region of gp41 and preventing the interaction of the HR1 and HR2 domains, which is required for virus–cell fusion.(By similar)
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00615
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C200H303N53O60
Absent amino acids CHMPV
Common amino acids L
Mass 4409.92
Pl 4.72
Basic residues 4
Acidic residues 6
Hydrophobic residues 14
Net charge -2
Boman Index -7927
Hydrophobicity -78.06
Aliphatic Index 92.22
Half Life
Extinction Coefficient cystines 17990
Absorbance 280nm 514
Polar residues 9
Literature Information
Literature 1
Title Optimization of peptidic HIV-1 fusion inhibitor T20 by phage display.
Pubmed ID 31228294
Reference Protein Sci. 2019 Aug;28(8):1501-1512.
Author Chen G, Cook JD, Ye W, Lee JE, Sidhu SS.
DOI 10.1002/pro.3669