DRAVP ID  DRAVPe00618

Peptide Name   T20v6(T20 [I5L, H6W, L8I, S12G, Q13R, Q15L, E22K])

Sequence  YTSLLWSIIEEGRNLQEKNEQKLLELDKWASLWNWF

Sequence Length  36

UniProt ID  P04578 

Taxon ID  None

Source  Synthetic construct(derived from T20)

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  HIV

Assay  neutralization assay

Activity 

• [Ref.31228294]HIV-1 N43:inhibition of virus infection in U87 cells(IC50=0.16 µg/ml);
• HIV-1 JRCSF:inhibition of virus infection in U87 cells(IC50=0.14 µg/ml);
• HIV-1 94UG103:inhibition of pseudovirus infection in U87 cells(IC50=0.21 µg/ml);
• HIV-1 92BR020:inhibition of pseudovirus infection in U87 cells(IC50=0.62 µg/ml);
• HIV-1 IAVI C22:inhibition of pseudovirus infection in U87 cells(IC50=0.59 µg/ml);
• HIV-1 92HT021:inhibition of pseudovirus infection in U87 cells(IC50=0.10 µg/ml);
• HIV-1 JRCSF-GIA:inhibition of pseudovirus infection in U87 cells(IC50=5.68 µg/ml).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  membrane

Mechanism  The peptide acts by binding to the heptad repeat 1 (HR1) region of gp41 and preventing the interaction of the HR1 and HR2 domains, which is required for virus–cell fusion.(By similar)

PDB ID  None

Predicted Structure Download  DRAVPe00618

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L

Literature 1

Title   Optimization of peptidic HIV-1 fusion inhibitor T20 by phage display.

Pubmed ID   31228294

Reference   Protein Sci. 2019 Aug;28(8):1501-1512.

Author   Chen G, Cook JD, Ye W, Lee JE, Sidhu SS.

DOI   10.1002/pro.3669