General Information


DRAVP ID  DRAVPe00647

Peptide Name   ENF (T-20)

Sequence  YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

Sequence Length  36

UniProt ID  P04578 

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HIV,SIV

Assay  MAGI/cMAGI infectivity assay,neutralization assay

Activity 

  • [Ref.17640899]HIV IIIB:inhibition of virus infection on CEM4 cells(IC50=0.006 μg/ml);
  • HIV 098:inhibition of virus infection on CEM4 cells(IC50=0.050 μg/ml);
  • HIV 098-T20:inhibition of virus infection on CEM4 cells(IC50=0.526 μg/ml);
  • HIV 098-T1249:inhibition of virus infection on CEM4 cells(IC50=54.958 μg/ml);
  • HIV 098-T651:inhibition of virus infection on CEM4 cells(IC50=47.822 μg/ml).
  • [Ref.31228294]HIV-1 N43:inhibition of virus infection in U87 cells(IC50=0.37 µg/ml);
  • HIV-1 JRCSF:inhibition of virus infection in U87 cells(IC50=0.09 µg/ml);
  • HIV-1 94UG103:inhibition of pseudovirus infection in U87 cells(IC50=0.03 µg/ml);
  • HIV-1 92BR020:inhibition of pseudovirus infection in U87 cells(IC50=0.30 µg/ml);
  • HIV-1 IAVI C22:inhibition of pseudovirus infection in U87 cells(IC50=0.03 µg/ml);
  • HIV-1 92HT021:inhibition of pseudovirus infection in U87 cells(IC50=0.02 µg/ml);
  • HIV-1 JRCSF-GIA:inhibition of pseudovirus infection in U87 cells(IC50=3.58 µg/ml).
  • [Ref.30089693]HIV-1 HXB2:inhibition of cell-cell fusion in TZM-bl cells(IC50=24633±2467 pM);
  • HIV-1 NL4-3:inhibition of pseudovirus infection in TZM-bl cells(IC50=10825±1354 pM);
  • HIV-1 JRCSF:inhibition of virus infection in TZM-bl cells(IC50=4503±384 pM);
  • HIV-1(3 A, 13 B, 7 C, 1 G, 1 A/C, 5 A/E, 6 B/C pseudovirus subtypes):inhibition of pseudovirus infection in TZM-bl cells(IC50=34858 pM);
  • T-20 sensitive HIV-1(NL4-3D36G):inhibition of virus infection in TZM-bl cells(IC50=9.12 nM);
  • T-20 resistant HIV-1 NL4-3(WT,I37T,V38A,V38 M,Q40H,N43K,G36S/V38 M,I37T/N43K,V38A/N42T):inhibition of virus infection in TZM-bl cells(IC50=90.18-2250 nM);
  • HIV-2(ROD,ST):inhibition of virus infection in TZM-bl cells(IC50=263.68-829.01 nM);
  • SIV(239,PBJ):inhibition of virus infection in TZM-bl cells(IC50=490.8-648.49 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.30089693]TZM-bl cell:CC50=157.87 ± 8.79 μM;
  • MT-4 cell:CC50=171.73± 23.13 μM;
  • HEK293T cell:CC50=216.23± 33.08 μM;
  • PBMC:CC50=81.23± 4.59 μM.

Binding Target  membrane

Mechanism  The peptide acts by binding to the heptad repeat 1 (HR1) region of gp41 and preventing the interaction of the HR1 and HR2 domains, which is required for virus–cell fusion.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C202H298N50O64

Absent amino acids  CGMPRV

Common amino acids  EL

Mass  4450.88

Pl  4.3

Basic residues  3

Acidic residues  7

Hydrophobic residues  13

Net charge  -4

Boman Index  -7259

Hydrophobicity  -87.5

Aliphatic Index  89.44

Half Life 

  •     Mammalian:2.8 hour
  •     Yeast:10 min
  •     E.coli:2 min

Extinction Coefficient cystines  17990

Absorbance 280nm  514

Polar residues  9



Literature Information


Literature 1

Title   Design of helical, oligomeric HIV-1 fusion inhibitor peptides with potent activity against enfuvirtide-resistant virus.

Pubmed ID   17640899

Reference   Proc Natl Acad Sci U S A. 2007 Jul 31;104(31):12772-7. 

Author   Dwyer JJ, Wilson KL, Davison DK, Freel SA, Seedorff JE, Wring SA, Tvermoes NA, Matthews TJ, Greenberg ML, Delmedico MK.

DOI   10.1073/pnas.0701478104

Literature 2

Title   Optimization of peptidic HIV-1 fusion inhibitor T20 by phage display.

Pubmed ID   31228294

Reference   Protein Sci. 2019 Aug;28(8):1501-1512.

Author   Chen G, Cook JD, Ye W, Lee JE, Sidhu SS.

DOI   10.1002/pro.3669

Literature 3

Title   Structural and Functional Characterization of Membrane Fusion Inhibitors with Extremely Potent Activity against Human Immunodeficiency Virus Type 1 (HIV-1), HIV-2, and Simian Immunodeficiency Virus.

Pubmed ID   30089693

Reference   J Virol. 2018 Sep 26;92(20):e01088-18.

Author   Chong H, Zhu Y, Yu D, He Y.

DOI   10.1128/JVI.01088-18