General Information
DRAVP ID DRAVPe00673
Peptide Name C34-C16
Sequence WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLX
Sequence Length 35
UniProt ID P03377
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV
Assay cell-fusion assay,single-cycle infection assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The peptide acts by binding to the heptad repeat 1 (HR1) region of gp41 and preventing the interaction of the HR1 and HR2 domains, which is required for virus–cell fusion.(By similar)
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification The 'X' at position 35 is Lys-C16(palmitic acid).
Stereochemistry L
Physicochemical Information
Formula C184H278N50O63S
Absent amino acids ACFGPV
Common amino acids E
Mass 4359.93
Pl 4.21
Basic residues 3
Acidic residues 8
Hydrophobic residues 9
Net charge -5
Boman Index -10170
Hydrophobicity -123.43
Aliphatic Index 78
Half Life
Extinction Coefficient cystines 12490
Absorbance 280nm 367.35
Polar residues 9
Literature Information
Literature 1
Title Structural and Functional Characterization of Membrane Fusion Inhibitors with Extremely Potent Activity against Human Immunodeficiency Virus Type 1 (HIV-1), HIV-2, and Simian Immunodeficiency Virus.
Pubmed ID 30089693
Reference J Virol. 2018 Sep 26;92(20):e01088-18.
Author Chong H, Zhu Y, Yu D, He Y.