General Information
DRAVP ID DRAVPe00722
Peptide Name T1562(FIV envelope protein (724-758))
Sequence IWNHGNITLGEWYNQTKDLQQKFYEIIMDIEQNNV
Sequence Length 35
UniProt ID P16090
Taxon ID None
Source Synthetic construct(derived from FIV envelope protein)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism FIV
Assay plaque-forming assay,RT infectivity assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00722
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C194H288N50O59S
Absent amino acids ACPRS
Common amino acids IN
Mass 4296.78
Pl 4.5
Basic residues 3
Acidic residues 5
Hydrophobic residues 11
Net charge -2
Boman Index -6406
Hydrophobicity -78.86
Aliphatic Index 86.29
Half Life
Extinction Coefficient cystines 13980
Absorbance 280nm 411.18
Polar residues 11
Literature Information
Literature 1
Title C-Terminal gp40 peptide analogs inhibit feline immunodeficiency virus: cell fusion and virus spread.
Pubmed ID 12186891
Reference J Virol. 2002 Sep;76(18):9079-86.
Author Medinas RJ, Lambert DM, Tompkins WA.