General Information
DRAVP ID DRAVPe00731
Peptide Name T1578(FIV envelope protein (735-769))
Sequence WYNQTKDLQQKFYEIIMDIEQNNVQGKKGIQQLQK
Sequence Length 35
UniProt ID P16090
Taxon ID None
Source Synthetic construct(derived from FIV envelope protein)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism FIV
Assay plaque-forming assay,RT infectivity assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00731
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C192H302N52O58S
Absent amino acids ACHPRS
Common amino acids Q
Mass 4298.88
Pl 8.3
Basic residues 5
Acidic residues 4
Hydrophobic residues 9
Net charge 1
Boman Index -8280
Hydrophobicity -121.43
Aliphatic Index 75.14
Half Life
Extinction Coefficient cystines 8480
Absorbance 280nm 249.41
Polar residues 8
Literature Information
Literature 1
Title C-Terminal gp40 peptide analogs inhibit feline immunodeficiency virus: cell fusion and virus spread.
Pubmed ID 12186891
Reference J Virol. 2002 Sep;76(18):9079-86.
Author Medinas RJ, Lambert DM, Tompkins WA.