General Information

General Information

DRAVP ID DRAVPe00735

Peptide Name T1589(FIV envelope protein (739-773))

Sequence TKDLQQKFYEIIMDIEQNNVQGKKGIQQLQKWEDW

Sequence Length 35

UniProt ID P16090

Source Synthetic construct(derived from FIV envelope protein)

Activity Information

Target Organism FIV,HIV

Assay plaque-forming assay,RT infectivity assay

Activity

[Ref.12186891]Feline immunodeficiency virus (FIV):inhibition of cell-cell fusion between FIV/CrFK cells and HeLa cells(EC50=1.145 μM,EC90>2.290 μM);
HIV-1:inhibition of cell-cell fusion between CEM4/IIIb cells and MOLT4 cells(EC50>2.321 μM,EC90>2.321 μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target Not found

Mechanism No machanism information found in the reference(s) presented in this entry

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00735

Linear/Cyclic Linear

N-terminal Modification Acetylation

C-terminal Modification Amidation

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C194H301N51O59S

Absent amino acids ACHPRS

Common amino acids Q

Mass 4323.89

Pl 4.99

Basic residues 5

Acidic residues 6

Hydrophobic residues 10

Net charge -1

Boman Index -8368

Hydrophobicity -120.29

Aliphatic Index 75.14

Half Life

Mammalian:7.2 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 12490

Absorbance 280nm 367.35

Polar residues 6

Literature Information

Literature 1

Title C-Terminal gp40 peptide analogs inhibit feline immunodeficiency virus: cell fusion and virus spread.

Pubmed ID 12186891

Reference J Virol. 2002 Sep;76(18):9079-86.

Author Medinas RJ, Lambert DM, Tompkins WA.

DOI 10.1128/jvi.76.18.9079-9086.2002