To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00736
Peptide Name T1566(FIV envelope protein (746-780))
Sequence FYEIIMDIEQNNVQGKKGIQQLQKWEDWVGWIGNI
Sequence Length 35
UniProt ID P16090
Source Synthetic construct(derived from FIV envelope protein)
Activity Information
Target Organism FIV
Assay plaque-forming assay,RT infectivity assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00736
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C194H291N49O55S
Absent amino acids ACHPRST
Common amino acids I
Mass 4221.8
Pl 4.51
Basic residues 3
Acidic residues 5
Hydrophobic residues 13
Net charge -2
Boman Index -4368
Hydrophobicity -54
Aliphatic Index 94.57
Half Life
Extinction Coefficient cystines 17990
Absorbance 280nm 529.12
Polar residues 8
Literature Information
Literature 1
Title C-Terminal gp40 peptide analogs inhibit feline immunodeficiency virus: cell fusion and virus spread.
Pubmed ID 12186891
Reference J Virol. 2002 Sep;76(18):9079-86.
Author Medinas RJ, Lambert DM, Tompkins WA.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.