DRAVP ID  DRAVPe00814

Peptide Name   IQN23

Sequence  RMKQIEDKIEEIESKQKKIENEIARIKKLIEAQQHLLQLTVWGIKQLQARIL

Sequence Length  52

UniProt ID  No entry found

Source  Synthetic construct

Other Link  DRAVPa0205

Target Organism  HIV

Assay  HIV luciferase assay

Activity 

• [Ref.11572974]HIV-1:inhibition of cell-cell fusion between 293T cells and HOS-CD4/fusion cells(IC50=0.015±0.007 µM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  membrane

Mechanism  The peptide inhibits HIV-1 entry by inhibiting the fusion between virus and cell membrane.

PDB ID  None

Predicted Structure Download  DRAVPe00814

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L

Literature 1

Title   Design of potent inhibitors of HIV-1 entry from the gp41 N-peptide region.

Pubmed ID   11572974

Reference   Proc Natl Acad Sci U S A. 2001 Sep 25;98(20):11187-92.

Author   Eckert DM, Kim PS.

DOI   10.1073/pnas.201392898