General Information
DRAVP ID DRAVPe00814
Peptide Name IQN23
Sequence RMKQIEDKIEEIESKQKKIENEIARIKKLIEAQQHLLQLTVWGIKQLQARIL
Sequence Length 52
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Other Link DRAVPa0205
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV
Assay HIV luciferase assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The peptide inhibits HIV-1 entry by inhibiting the fusion between virus and cell membrane.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00814
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C279H480N80O79S
Absent amino acids CFPY
Common amino acids IK
Mass 6251.43
Pl 9.52
Basic residues 12
Acidic residues 8
Hydrophobic residues 20
Net charge 4
Boman Index -11271
Hydrophobicity -61.35
Aliphatic Index 123.85
Half Life
Extinction Coefficient cystines 5500
Absorbance 280nm 107.84
Polar residues 4
Literature Information
Literature 1
Title Design of potent inhibitors of HIV-1 entry from the gp41 N-peptide region.
Pubmed ID 11572974
Reference Proc Natl Acad Sci U S A. 2001 Sep 25;98(20):11187-92.
Author Eckert DM, Kim PS.