To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00819
Peptide Name IIN17
Sequence RMKQIEDKIEEIESKIKKIENEIARIKKLLQLTVWGIKQLQARIL
Sequence Length 45
UniProt ID No entry found
Source Synthetic construct
Activity Information
Target Organism HIV
Assay HIV luciferase assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The peptide inhibits HIV-1 entry by inhibiting the fusion between virus and cell membrane.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00819
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C244H426N68O67S
Absent amino acids CFHPY
Common amino acids I
Mass 5416.54
Pl 9.78
Basic residues 11
Acidic residues 7
Hydrophobic residues 18
Net charge 4
Boman Index -9135
Hydrophobicity -45.11
Aliphatic Index 132.22
Half Life
Extinction Coefficient cystines 5500
Absorbance 280nm 125
Polar residues 4
Literature Information
Literature 1
Title Design of potent inhibitors of HIV-1 entry from the gp41 N-peptide region.
Pubmed ID 11572974
Reference Proc Natl Acad Sci U S A. 2001 Sep 25;98(20):11187-92.
Author Eckert DM, Kim PS.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.