General Information


DRAVP ID  DRAVPe00899

Peptide Name   T-106

Sequence  NFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSD

Sequence Length  35

UniProt ID  P69353 

Source  Synthetic construct(derived from Respiratory syncytial virus(RSV) fusion (F) protein)



Activity Information


Target Organism  RSV

Assay  Cytopathic effect(CPE) assay

Activity 

  • [Ref.8700906]Respiratory syncytial virus(RSV):protection of HEp2 cell from viral cytopathic effect(CPE)(EC50>100 μg/ml).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.8700906]No significant cytotoxic against HEp2 cells(CC50>100 μM).

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00899

Linear/Cyclic  Linear

N-terminal Modification  Acetylation

C-terminal Modification  Amidation

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C182H273N45O59

Absent amino acids  CGHMTW

Common amino acids  S

Mass  4035.44

Pl  4.23

Basic residues  3

Acidic residues  6

Hydrophobic residues  13

Net charge  -3

Boman Index  -7444

Hydrophobicity  -42.86

Aliphatic Index  78

Half Life 

  •     Mammalian:1.4 hour
  •     Yeast:3 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  1490

Absorbance 280nm  43.82

Polar residues  9



Literature Information


Literature 1

Title   Peptides from conserved regions of paramyxovirus fusion (F) proteins are potent inhibitors of viral fusion. 

Pubmed ID   8700906

Reference   Proc Natl Acad Sci U S A. 1996 Mar 5;93(5):2186-91.

Author   Lambert DM, Barney S, Lambert AL, Guthrie K, Medinas R, Davis DE, Bucy T, Erickson J, Merutka G, Petteway SR Jr.

DOI   10.1073/pnas.93.5.2186