General Information


DRAVP ID  DRAVPe01269

Peptide Name   HR1-1(HR1 region 889–926)

Sequence  NGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTA

Sequence Length  38

UniProt ID  P59594 

Taxon ID  None

Source  Synthetic construct(derived from SARS-CoV spike protein)

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  SARS-CoV

Assay  luciferase assay

Activity 

  • [Ref.15184046]HIV-luc/SARS pseudotyped virus:inhibition of virus infection in 293T cells(EC50=0.14 μM);
  • SARS-CoV(wild-type):inhibition of virus infection in 293T cells(EC50=3.68 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  membrane

Mechanism  soluble synthesized HR1, HR2 or homologues can bind the exposed HR1 or HR2 region and block the formation of the six-helix bundle, thus inhibiting virus fusion with the target cell.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe01269

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C178H291N51O63

Absent amino acids  CDHMPRW

Common amino acids  Q

Mass  4153.57

Pl  6.14

Basic residues  2

Acidic residues  2

Hydrophobic residues  12

Net charge  0

Boman Index  -6646

Hydrophobicity  -50.26

Aliphatic Index  84.74

Half Life 

  •     Mammalian:1.4 hour
  •     Yeast:3 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  1490

Absorbance 280nm  40.27

Polar residues  16



Literature Information


Literature 1

Title   Suppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.

Pubmed ID   15184046

Reference   Biochem Biophys Res Commun. 2004 Jul 2;319(3):746-52.

Author   Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.

DOI   10.1016/j.bbrc.2004.05.046