To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01269
Peptide Name HR1-1(HR1 region 889–926)
Sequence NGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTA
Sequence Length 38
UniProt ID P59594
Source Synthetic construct(derived from SARS-CoV spike protein)
Activity Information
Target Organism SARS-CoV
Assay luciferase assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism soluble synthesized HR1, HR2 or homologues can bind the exposed HR1 or HR2 region and block the formation of the six-helix bundle, thus inhibiting virus fusion with the target cell.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01269
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C178H291N51O63
Absent amino acids CDHMPRW
Common amino acids Q
Mass 4153.57
Pl 6.14
Basic residues 2
Acidic residues 2
Hydrophobic residues 12
Net charge 0
Boman Index -6646
Hydrophobicity -50.26
Aliphatic Index 84.74
Half Life
Extinction Coefficient cystines 1490
Absorbance 280nm 40.27
Polar residues 16
Literature Information
Literature 1
Title Suppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.
Pubmed ID 15184046
Reference Biochem Biophys Res Commun. 2004 Jul 2;319(3):746-52.
Author Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.