General Information
DRAVP ID DRAVPe01299
Peptide Name sHR2-8(derived from SARS-CoV spike protein heptad repeat)
Sequence ELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIK
Sequence Length 68
UniProt ID P59594
Taxon ID None
Source Synthetic construct(derived from SARS-CoV spike protein heptad repeat)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism SARS-CoV
Assay Indirect immunofluorescence assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism The peptide exhibits antiviral activity by competitive binding to the HR8 region of the SARS-CoV spike protein, thus blocking the formation of the six-helix bundle and consequently membrane fusion.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01299
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C346H549N89O117
Absent amino acids CMW
Common amino acids ELDK
Mass 7827.69
Pl 4.46
Basic residues 9
Acidic residues 15
Hydrophobic residues 22
Net charge -6
Boman Index -15296
Hydrophobicity -69.12
Aliphatic Index 100.29
Half Life
Extinction Coefficient cystines 4470
Absorbance 280nm 66.72
Polar residues 18
Literature Information
Literature 1
Title Severe acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.
Pubmed ID 15150417
Reference Proc Natl Acad Sci U S A. 2004 Jun 1;101(22):8455-60.
Author Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.