General Information


DRAVP ID  DRAVPe01302

Peptide Name   mHR2(derived from SARS-CoV spike protein heptad repeat)

Sequence  DLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKE

Sequence Length  39

UniProt ID  P11224 

Taxon ID  None

Source  Synthetic construct(derived from SARS-CoV spike protein heptad repeat)

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  SARS-CoV

Assay  Indirect immunofluorescence assay

Activity 

  • [Ref.15150417]SARS-CoV:inhibition of virus infection in Vero cells(EC50>50 μM);
  • murine coronavirus:inhibition of virus infection in Vero cells(EC50=0.9 ± 0.1 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  membrane

Mechanism  The peptide exhibits antiviral activity by competitive binding to the HR11 region of the SARS-CoV spike protein, thus blocking the formation of the six-helix bundle and consequently membrane fusion.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe01302

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C207H337N51O67S

Absent amino acids  CGHPW

Common amino acids  L

Mass  4644.31

Pl  4.51

Basic residues  5

Acidic residues  8

Hydrophobic residues  14

Net charge  -3

Boman Index  -7826

Hydrophobicity  -42.56

Aliphatic Index  120

Half Life 

  •     Mammalian:1.1 hour
  •     Yeast:3 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  2980

Absorbance 280nm  78.42

Polar residues  10



Literature Information


Literature 1

Title   Severe acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.

Pubmed ID   15150417

Reference   Proc Natl Acad Sci U S A. 2004 Jun 1;101(22):8455-60.

Author   Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.

DOI   10.1073/pnas.0400576101