To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01302
Peptide Name mHR2(derived from SARS-CoV spike protein heptad repeat)
Sequence DLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKE
Sequence Length 39
UniProt ID P11224
Source Synthetic construct(derived from SARS-CoV spike protein heptad repeat)
Activity Information
Target Organism SARS-CoV
Assay Indirect immunofluorescence assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism The peptide exhibits antiviral activity by competitive binding to the HR11 region of the SARS-CoV spike protein, thus blocking the formation of the six-helix bundle and consequently membrane fusion.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01302
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C207H337N51O67S
Absent amino acids CGHPW
Common amino acids L
Mass 4644.31
Pl 4.51
Basic residues 5
Acidic residues 8
Hydrophobic residues 14
Net charge -3
Boman Index -7826
Hydrophobicity -42.56
Aliphatic Index 120
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 78.42
Polar residues 10
Literature Information
Literature 1
Title Severe acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.
Pubmed ID 15150417
Reference Proc Natl Acad Sci U S A. 2004 Jun 1;101(22):8455-60.
Author Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.