DRAVP ID  DRAVPe01308

Peptide Name   HeV F HRC derived peptide(447-488)

Sequence  PPVYTKDVDISSQISSMNQSLQQSKDYIKEAQKILDTVNPSL

Sequence Length  42

UniProt ID  O89342 

Source  Synthetic construct(derived from HeV fusion (F) protein)

Target Organism  HeV,HPIV3

Assay  Luminescence fusion assay

Activity 

• [Ref.16973588]Henda virus(HeV):inhibition of virus infection in HeLa cells(IC50=75 nM);inhibition of fusion in HeLa cells(IC50=40 nM);
• human parainfluenza virus 3 (HPIV3):inhibition of virus infection in HeLa cells(IC50>10000 nM);inhibition of fusion in HeLa cells(IC50>10000 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  membrane

Mechanism  The HeV receptor-binding protein (G) is required in order for the fusion protein (F) to mediate fusion. HeV F, once triggered by the receptor-bound G, undergoes multistep conformational changes leading to a six-helix bundle (6HB) structure that accomplishes fusion of the viral and cellular membranes. Peptides derived from the HRN and HRC regions of F are proposed to inhibit fusion by preventing F, after the initial triggering step, from forming the 6HB structure that is required for fusion.

PDB ID  None

Predicted Structure Download  DRAVPe01308

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L

Literature 1

Title   Inhibition of hendra virus fusion.

Pubmed ID   16973588

Reference   J Virol. 2006 Oct;80(19):9837-49.

Author   Porotto M, Doctor L, Carta P, Fornabaio M, Greengard O, Kellogg GE, Moscona A.

DOI   10.1128/JVI.00736-06