General Information
DRAVP ID DRAVPe01308
Peptide Name HeV F HRC derived peptide(447-488)
Sequence PPVYTKDVDISSQISSMNQSLQQSKDYIKEAQKILDTVNPSL
Sequence Length 42
UniProt ID O89342
Taxon ID None
Source Synthetic construct(derived from HeV fusion (F) protein)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not available
Activity Information
Target Organism HeV,HPIV3
Assay Luminescence fusion assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism The HeV receptor-binding protein (G) is required in order for the fusion protein (F) to mediate fusion. HeV F, once triggered by the receptor-bound G, undergoes multistep conformational changes leading to a six-helix bundle (6HB) structure that accomplishes fusion of the viral and cellular membranes. Peptides derived from the HRN and HRC regions of F are proposed to inhibit fusion by preventing F, after the initial triggering step, from forming the 6HB structure that is required for fusion.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01308
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C205H335N53O71S
Absent amino acids CFGHRW
Common amino acids S
Mass 4710.29
Pl 4.78
Basic residues 4
Acidic residues 5
Hydrophobic residues 11
Net charge -1
Boman Index -8337
Hydrophobicity -62.62
Aliphatic Index 88.1
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 72.68
Polar residues 13
Literature Information
Literature 1
Title Inhibition of hendra virus fusion.
Pubmed ID 16973588
Reference J Virol. 2006 Oct;80(19):9837-49.
Author Porotto M, Doctor L, Carta P, Fornabaio M, Greengard O, Kellogg GE, Moscona A.