General Information
DRAVP ID DRAVPe01310
Peptide Name HPIV3 F HRC derived peptide(442-486)
Sequence DITLNNSVALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSIGN
Sequence Length 45
UniProt ID P06828
Taxon ID None
Source Synthetic construct(derived from HPIV3 fusion (F) protein)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HeV,HPIV3
Assay Luminescence fusion assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism The HeV receptor-binding protein (G) is required in order for the fusion protein (F) to mediate fusion. HeV F, once triggered by the receptor-bound G, undergoes multistep conformational changes leading to a six-helix bundle (6HB) structure that accomplishes fusion of the viral and cellular membranes. Peptides derived from the HRN and HRC regions of F are proposed to inhibit fusion by preventing F, after the initial triggering step, from forming the 8HB structure that is required for fusion.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01310
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C218H362N62O77
Absent amino acids CFHMY
Common amino acids IS
Mass 5083.64
Pl 4.56
Basic residues 6
Acidic residues 9
Hydrophobic residues 15
Net charge -3
Boman Index -11954
Hydrophobicity -70.44
Aliphatic Index 106.22
Half Life
Extinction Coefficient cystines 5500
Absorbance 280nm 125
Polar residues 13
Literature Information
Literature 1
Title Inhibition of hendra virus fusion.
Pubmed ID 16973588
Reference J Virol. 2006 Oct;80(19):9837-49.
Author Porotto M, Doctor L, Carta P, Fornabaio M, Greengard O, Kellogg GE, Moscona A.