General Information


DRAVP ID  DRAVPe01312

Peptide Name   HPIV3 F HRC derived peptide(449-484)[L451N]

Sequence  VANDPIDISIELNKAKSDLEESKEWIRRSNQKLDSI

Sequence Length  36

UniProt ID  P06828 

Taxon ID  None

Source  Synthetic construct(derived from HPIV3 fusion (F) protein)

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HeV,HPIV3

Assay  Luminescence fusion assay

Activity 

  • [Ref.16973588]Henda virus(HeV):inhibition of virus infection in HeLa cells(IC50=100 nM);inhibition of fusion in HeLa cells(IC50=3000 nM);
  • human parainfluenza virus 3 (HPIV3):inhibition of virus infection in HeLa cells(IC50=1100 nM);inhibition of fusion in HeLa cells(IC50=750 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  membrane

Mechanism  The HeV receptor-binding protein (G) is required in order for the fusion protein (F) to mediate fusion. HeV F, once triggered by the receptor-bound G, undergoes multistep conformational changes leading to a six-helix bundle (6HB) structure that accomplishes fusion of the viral and cellular membranes. Peptides derived from the HRN and HRC regions of F are proposed to inhibit fusion by preventing F, after the initial triggering step, from forming the 11HB structure that is required for fusion.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe01312

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C179H297N51O62

Absent amino acids  CFGHMTY

Common amino acids  IS

Mass  4155.63

Pl  4.77

Basic residues  6

Acidic residues  8

Hydrophobic residues  12

Net charge  -2

Boman Index  -10727

Hydrophobicity  -87.22

Aliphatic Index  100.28

Half Life 

  •     Mammalian:100 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  5500

Absorbance 280nm  157.14

Polar residues  8



Literature Information


Literature 1

Title   Inhibition of hendra virus fusion.

Pubmed ID   16973588

Reference   J Virol. 2006 Oct;80(19):9837-49.

Author   Porotto M, Doctor L, Carta P, Fornabaio M, Greengard O, Kellogg GE, Moscona A.

DOI   10.1128/JVI.00736-06