To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01336
Peptide Name hEP-1
Sequence EELRVRLASHLRKLRKRLLRDADDLQKRLAVYEEQAQQIRLQAEAFQARLKSWFEPLVEDM
Sequence Length 61
UniProt ID P02649
Taxon ID None
Source Synthetic construct(derived from human apolipoprotein E)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not available
Activity Information
Target Organism HCV
Assay RT PCR
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target
Mechanism hEP peptide blocks the binding of virus to cells, suggesting a role of apoE at the very early stage of HCV entry.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01336
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C327H539N101O93S
Absent amino acids CGNT
Common amino acids L
Mass 7405.56
Pl 9.4
Basic residues 14
Acidic residues 11
Hydrophobic residues 25
Net charge 3
Boman Index -18940
Hydrophobicity -74.1
Aliphatic Index 102.46
Half Life
Extinction Coefficient cystines 6990
Absorbance 280nm 116.5
Polar residues 3
Literature Information
Literature 1
Title Human apolipoprotein E peptides inhibit hepatitis C virus entry by blocking virus binding.
Pubmed ID 22334503
Reference Hepatology. 2012 Aug;56(2):484-91.
Author Liu S, McCormick KD, Zhao W, Zhao T, Fan D, Wang T.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.