To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01343
Peptide Name hEP-6
Sequence VRLASHLRKLRKRLLRDADDLIRLQAEAFQARLKSWFEPLV
Sequence Length 41
UniProt ID P02649
Source Synthetic construct(derived from human apolipoprotein E)
Activity Information
Target Organism HCV
Assay RT PCR
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not found
Mechanism hEP peptide blocks the binding of virus to cells, suggesting a role of apoE at the very early stage of HCV entry.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01343
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C223H372N70O56
Absent amino acids CGMNTY
Common amino acids L
Mass 4929.84
Pl 11.29
Basic residues 11
Acidic residues 5
Hydrophobic residues 20
Net charge 6
Boman Index -10879
Hydrophobicity -32.44
Aliphatic Index 121.46
Half Life
Extinction Coefficient cystines 5500
Absorbance 280nm 137.5
Polar residues 2
Literature Information
Literature 1
Title Human apolipoprotein E peptides inhibit hepatitis C virus entry by blocking virus binding.
Pubmed ID 22334503
Reference Hepatology. 2012 Aug;56(2):484-91.
Author Liu S, McCormick KD, Zhao W, Zhao T, Fan D, Wang T.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.