General Information
DRAVP ID DRAVPe01422
Peptide Name gH493-537(derived from HSV-1 H glycoprotein)
Sequence AAHLIDALYAEFLGGRVLTTPVVHRALFYASAVLRQPFLAGVPSA
Sequence Length 45
UniProt ID Q9DHD5
Taxon ID None
Source Synthetic construct(derived from HSV-1 H glycoprotein (gH))
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HSV
Assay Plaque assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target mambrane
Mechanism The peptide inhibits virus entry and thus protects cells from infection.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01422
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C224H349N59O57
Absent amino acids CKMNW
Common amino acids A
Mass 4780.6
Pl 8.64
Basic residues 5
Acidic residues 2
Hydrophobic residues 25
Net charge 3
Boman Index 24
Hydrophobicity 77.11
Aliphatic Index 121.56
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 67.73
Polar residues 9
Literature Information
Literature 1
Title Peptides containing membrane-interacting motifs inhibit herpes simplex virus type 1 infectivity.
Pubmed ID 18572274
Reference Peptides. 2008 Sep;29(9):1461-71.
Author Galdiero S, Falanga A, Vitiello M, D'Isanto M, Cantisani M, Kampanaraki A, Benedetti E, Browne H, Galdiero M.