General Information


DRAVP ID  DRAVPe01422

Peptide Name   gH493-537(derived from HSV-1 H glycoprotein)

Sequence  AAHLIDALYAEFLGGRVLTTPVVHRALFYASAVLRQPFLAGVPSA

Sequence Length  45

UniProt ID  Q9DHD5 

Taxon ID  None

Source  Synthetic construct(derived from HSV-1 H glycoprotein (gH))

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HSV

Assay  Plaque assay

Activity 

  • [Ref.18572274]Herpes simplex virus type 1(HSV-1):inhibition of viral-entry in Vero cells(50-60% inhibition at 250μM-500μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.18572274]No cytotoxicity against Vero cells up to 500 μM.

Binding Target  mambrane

Mechanism  The peptide inhibits virus entry and thus protects cells from infection.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe01422

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C224H349N59O57

Absent amino acids  CKMNW

Common amino acids  A

Mass  4780.6

Pl  8.64

Basic residues  5

Acidic residues  2

Hydrophobic residues  25

Net charge  3

Boman Index  24

Hydrophobicity  77.11

Aliphatic Index  121.56

Half Life 

  •     Mammalian:4.4 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  2980

Absorbance 280nm  67.73

Polar residues  9



Literature Information


Literature 1

Title   Peptides containing membrane-interacting motifs inhibit herpes simplex virus type 1 infectivity.

Pubmed ID   18572274

Reference   Peptides. 2008 Sep;29(9):1461-71.

Author   Galdiero S, Falanga A, Vitiello M, D'Isanto M, Cantisani M, Kampanaraki A, Benedetti E, Browne H, Galdiero M.

DOI   10.1016/j.peptides.2008.04.022