General Information

General Information

DRAVP ID DRAVPe01422

Peptide Name gH493-537(derived from HSV-1 H glycoprotein)

Sequence AAHLIDALYAEFLGGRVLTTPVVHRALFYASAVLRQPFLAGVPSA

Sequence Length 45

UniProt ID Q9DHD5

Source Synthetic construct(derived from HSV-1 H glycoprotein (gH))

Activity Information

Target Organism HSV

Assay Plaque assay

Activity

[Ref.18572274]Herpes simplex virus type 1(HSV-1):inhibition of viral-entry in Vero cells(50-60% inhibition at 250μM-500μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.18572274]No cytotoxicity against Vero cells up to 500 μM.

Binding Target mambrane

Mechanism The peptide inhibits virus entry and thus protects cells from infection.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe01422

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C224H349N59O57

Absent amino acids CKMNW

Common amino acids A

Mass 4780.6

Pl 8.64

Basic residues 5

Acidic residues 2

Hydrophobic residues 25

Net charge 3

Boman Index 24

Hydrophobicity 77.11

Aliphatic Index 121.56

Half Life

Mammalian:4.4 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 2980

Absorbance 280nm 67.73

Polar residues 9

Literature Information

Literature 1

Title Peptides containing membrane-interacting motifs inhibit herpes simplex virus type 1 infectivity.

Pubmed ID 18572274

Reference Peptides. 2008 Sep;29(9):1461-71.

Author Galdiero S, Falanga A, Vitiello M, D'Isanto M, Cantisani M, Kampanaraki A, Benedetti E, Browne H, Galdiero M.

DOI 10.1016/j.peptides.2008.04.022