To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01425
Peptide Name Pcr-400
Sequence CCFLNITNSHVSILQERPPLENRVLTGWGL
Sequence Length 30
UniProt ID P14075
Source Synthetic construct(derived from HTLV-1 envelope glycoprotein (gp21))
Activity Information
Target Organism HTLV
Assay Luciferase assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target mambrane
Mechanism The peptide is an effective inhibitor of HTLV-1 envelope-catalyzed membrane fusion and thus inhibits virus entry.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01425
Linear/Cyclic Linear
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C151H241N43O43S2
Absent amino acids ADKMY
Common amino acids L
Mass 3410.96
Pl 6.74
Basic residues 3
Acidic residues 2
Hydrophobic residues 11
Net charge 1
Boman Index -3325
Hydrophobicity 10.33
Aliphatic Index 110.33
Half Life
Extinction Coefficient cystines 5625
Absorbance 280nm 193.97
Polar residues 11
Literature Information
Literature 1
Title Basic residues are critical to the activity of peptide inhibitors of human T cell leukemia virus type 1 entry.
Pubmed ID 19114713
Reference J Biol Chem. 2009 Mar 6;284(10):6575-84.
Author Lamb D, Mirsaliotis A, Kelly SM, Brighty DW.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.