To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01431
Peptide Name G163-197(derived from RSV attachment glycoprotein)
Sequence FHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKK
Sequence Length 35
UniProt ID P03423
Source Synthetic construct(derived from RSV attachment glycoprotein)
Activity Information
Target Organism RSV
Assay NMR
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01431
Linear/Cyclic Cyclic
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification The peptide formed two disulfide bonds.
Stereochemistry L
Physicochemical Information
Formula C185H282N50O45S4
Absent amino acids DLMQY
Common amino acids K
Mass 4054.82
Pl 9.44
Basic residues 7
Acidic residues 1
Hydrophobic residues 11
Net charge 6
Boman Index -4511
Hydrophobicity -28
Aliphatic Index 52.86
Half Life
Extinction Coefficient cystines 5750
Absorbance 280nm 169.12
Polar residues 12
Literature Information
Literature 1
Title Antiviral activity and structural characteristics of the nonglycosylated central subdomain of human respiratory syncytial virus attachment (G) glycoprotein.
Pubmed ID 11487583
Reference J Biol Chem. 2001 Oct 19;276(42):38988-94.
Author Gorman JJ, McKimm-Breschkin JL, Norton RS, Barnham KJ.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.