General Information
DRAVP ID DRAVPe01436
Peptide Name G158-189(derived from RSV attachment glycoprotein)
Sequence KPNNDFHFEVFNFVPCSICSNNPTCWAICKRI
Sequence Length 32
UniProt ID P03423
Taxon ID None
Source Synthetic construct(derived from RSV attachment glycoprotein)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism RSV
Assay NMR
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01436
Linear/Cyclic Cyclic
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification The peptide formed two disulfide bonds.
Stereochemistry L
Physicochemical Information
Formula C168H247N45O45S4
Absent amino acids GLMQY
Common amino acids N
Mass 3745.32
Pl 7.89
Basic residues 4
Acidic residues 2
Hydrophobic residues 11
Net charge 2
Boman Index -4476
Hydrophobicity -9.69
Aliphatic Index 57.81
Half Life
Extinction Coefficient cystines 5750
Absorbance 280nm 185.48
Polar residues 12
Literature Information
Literature 1
Title Antiviral activity and structural characteristics of the nonglycosylated central subdomain of human respiratory syncytial virus attachment (G) glycoprotein.
Pubmed ID 11487583
Reference J Biol Chem. 2001 Oct 19;276(42):38988-94.
Author Gorman JJ, McKimm-Breschkin JL, Norton RS, Barnham KJ.