General Information

General Information

DRAVP ID DRAVPe01529

Peptide Name LL-37 (human cathelicidin LL-37)

Sequence [LL-37, 37 aa]

Sequence Length 37

UniProt ID P49913

Source neutrophils, monocytes; mast cells; lymphocytes, Mesenchymal Stem Cells; islets; skin, sweat; airway surface liquid, saliva; Homo sapiens; Also Pan troglodytes

Activity Information

Target Organism HSV, EBOV

Assay Plaque assay

Activity

[Ref.30669255]HSV-1:inhibition of HSV-1 replication in human keratinocytes(75% inhibition at 1.25 µM,94% inhibition at 2.5 µM).
[Ref.32252021]Ebola Virus(EBOV):inhibition of viral infection in Hela cells(IC50=4.03 µM);inhibition of viral infection in primary macrophages(IC50>20 µM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.30669255]Significant cytotoxicity was observed on Keratinocyte at the concentration of 5 μM with a cell viability of 80%.

Binding Target Not found

Mechanism Act as CatB inhibitors to block the endosomal processing of EBOV GP, thus preventing virus entry.

Structure Information

PDB ID 2K6O

Predicted Structure Download DRAVPe01529

Linear/Cyclic Cyclic

N-terminal Modification Cyclization (N termini to C termini)

C-terminal Modification Cyclization (N termini to C termini)

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C205H340N60O53

Absent amino acids ACHMWY

Common amino acids K

Mass 4493.32

Pl 10.61

Basic residues 11

Acidic residues 5

Hydrophobic residues 13

Net charge 6

Boman Index -11100

Hydrophobicity -72.43

Aliphatic Index 89.46

Half Life

Mammalian:5.5 hour
Yeast:3 min
E.coli:2 min

Extinction Coefficient cystines 0

Absorbance 280nm 0

Polar residues 6

Literature Information

Literature 1

Title Comparison of Anti-Viral Activity of Frog Skin Anti-Microbial Peptides Temporin-Sha and [K³]SHa to LL-37 and Temporin-Tb against Herpes Simplex Virus Type 1.

Pubmed ID 30669255

Reference Viruses. 2019 Jan 18;11(1):77.

Author Roy M, Lebeau L, Chessa C, Damour A, Ladram A, Oury B, Boutolleau D, Bodet C, Lévêque N.

DOI 10.3390/v11010077

Literature 2

Title Engineered Human Cathelicidin Antimicrobial Peptides Inhibit Ebola Virus Infection.

Pubmed ID 32252021

Reference iScience. 2020 Apr 24;23(4):100999.

Author Yu Y, Cooper CL, Wang G, Morwitzer MJ, Kota K, Tran JP, Bradfute SB, Liu Y, Shao J, Zhang AK, Luo LG, Reid SP, Hinrichs SH, Su K.

DOI 10.1016/j.isci.2020.100999