General Information
DRAVP ID DRAVPe01529
Peptide Name LL-37 (human cathelicidin LL-37)
Sequence [LL-37, 37 aa]
Sequence Length 37
UniProt ID P49913
Taxon ID None
Source neutrophils, monocytes; mast cells; lymphocytes, Mesenchymal Stem Cells; islets; skin, sweat; airway surface liquid, saliva; Homo sapiens; Also Pan troglodytes
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not available
Activity Information
Target Organism HSV, EBOV
Assay Plaque assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism Act as CatB inhibitors to block the endosomal processing of EBOV GP, thus preventing virus entry.
Structure Information
PDB ID 2K6O
Predicted Structure Download DRAVPe01529
Linear/Cyclic Cyclic
N-terminal Modification Cyclization (N termini to C termini)
C-terminal Modification Cyclization (N termini to C termini)
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C205H340N60O53
Absent amino acids ACHMWY
Common amino acids K
Mass 4493.32
Pl 10.61
Basic residues 11
Acidic residues 5
Hydrophobic residues 13
Net charge 6
Boman Index -11100
Hydrophobicity -72.43
Aliphatic Index 89.46
Half Life
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 6
Literature Information
Literature 1
Title Comparison of Anti-Viral Activity of Frog Skin Anti-Microbial Peptides Temporin-Sha and [K³]SHa to LL-37 and Temporin-Tb against Herpes Simplex Virus Type 1.
Pubmed ID 30669255
Reference Viruses. 2019 Jan 18;11(1):77.
Author Roy M, Lebeau L, Chessa C, Damour A, Ladram A, Oury B, Boutolleau D, Bodet C, Lévêque N.
Literature 2
Title Engineered Human Cathelicidin Antimicrobial Peptides Inhibit Ebola Virus Infection.
Pubmed ID 32252021
Reference iScience. 2020 Apr 24;23(4):100999.
Author Yu Y, Cooper CL, Wang G, Morwitzer MJ, Kota K, Tran JP, Bradfute SB, Liu Y, Shao J, Zhang AK, Luo LG, Reid SP, Hinrichs SH, Su K.