General Information


DRAVP ID  DRAVPe01530

Peptide Name   LL-37[F5,6L]

Sequence  LLGDLLRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Sequence Length  37

UniProt ID  No entry found

Taxon ID  None

Source  Synthetic construct(derived from human cathelicidin LL-37)

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not available



Activity Information


Target Organism  HIV

Assay 

Activity 

  • [Ref.18591279]HIV-1IIIB:inhibition the cytopathic effect of HIV in CEM-SS cells(EC50=1.6 μM).(EC50:50% effective concentration for inhibition of virus replication)

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.18591279]CEM-SS cells:TC50=18.4 μM.(TC50:the concentration that reduced cell viability by 50%)

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe01530

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C199H344N60O53

Absent amino acids  ACHMWY

Common amino acids  KL

Mass  4425.29

Pl  10.61

Basic residues  11

Acidic residues  5

Hydrophobic residues  13

Net charge  6

Boman Index  -10712

Hydrophobicity  -67.03

Aliphatic Index  110.54

Half Life 

  •     Mammalian:5.5 hour
  •     Yeast:3 min
  •     E.coli:2 min

Extinction Coefficient cystines  0

Absorbance 280nm  0

Polar residues  6



Literature Information


Literature 1

Title   Anti-human immunodeficiency virus type 1 activities of antimicrobial peptides derived from human and bovine cathelicidins.

Pubmed ID   18591279

Reference   Antimicrob Agents Chemother. 2008 Sep;52(9):3438-40. 

Author   Wang G, Watson KM, Buckheit RW Jr. 

DOI   10.1128/AAC.00452-08