To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01530
Peptide Name LL-37[F5,6L]
Sequence LLGDLLRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Sequence Length 37
UniProt ID No entry found
Source Synthetic construct(derived from human cathelicidin LL-37)
Activity Information
Target Organism HIV
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01530
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C199H344N60O53
Absent amino acids ACHMWY
Common amino acids KL
Mass 4425.29
Pl 10.61
Basic residues 11
Acidic residues 5
Hydrophobic residues 13
Net charge 6
Boman Index -10712
Hydrophobicity -67.03
Aliphatic Index 110.54
Half Life
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 6
Literature Information
Literature 1
Title Anti-human immunodeficiency virus type 1 activities of antimicrobial peptides derived from human and bovine cathelicidins.
Pubmed ID 18591279
Reference Antimicrob Agents Chemother. 2008 Sep;52(9):3438-40.
Author Wang G, Watson KM, Buckheit RW Jr.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.