To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01552
Peptide Name EC-hepcidin1
Sequence MKTFSVAVAVAIVLAFICTQESSALPVTGVEELVELVSSDDPVADHQELPVELGERLFNIRKKRASPKCTPYCYPTRDGVFCGVRCDF
Sequence Length 88
UniProt ID No entry found
Source Epinephelus coioides
Activity Information
Target Organism SGIV
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01552
Linear/Cyclic Cyclic
N-terminal Modification Free
C-terminal Modification Free
Other Modification There are two pairs of disulfide bonds.
Stereochemistry L
Physicochemical Information
Formula C429H682N112O129S6
Absent amino acids W
Common amino acids V
Mass 9665.17
Pl 4.99
Basic residues 10
Acidic residues 12
Hydrophobic residues 34
Net charge -2
Boman Index -10622
Hydrophobicity 17.73
Aliphatic Index 91.82
Half Life
Extinction Coefficient cystines 3230
Absorbance 280nm 37.13
Polar residues 23
Literature Information
Literature 1
Title Molecular cloning and characterization of two novel hepcidins from orange-spotted grouper, Epinephelus coioides.
Pubmed ID 21145974
Reference Fish Shellfish Immunol. 2011 Feb;30(2):559-68.
Author Zhou JG, Wei JG, Xu D, Cui HC, Yan Y, Ou-Yang ZL, Huang XH, Huang YH, Qin QW.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.