DRAVP ID  DRAVPe01552

Peptide Name   EC-hepcidin1

Sequence  MKTFSVAVAVAIVLAFICTQESSALPVTGVEELVELVSSDDPVADHQELPVELGERLFNIRKKRASPKCTPYCYPTRDGVFCGVRCDF

Sequence Length  88

UniProt ID  No entry found

Taxon ID  None

Source  Epinephelus coioides

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not available

Target Organism  SGIV

Assay 

Activity 

• [Ref.21145974]Singapore grouper iridovirus (SGIV):strongly inhibit the replication of SGIV.(EC-hepcidin1 is more active than EC-hepcidin2)

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry

PDB ID  None

Predicted Structure Download  DRAVPe01552

Linear/Cyclic  Cyclic

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  There are two pairs of disulfide bonds.

Stereochemistry  L

Literature 1

Title   Molecular cloning and characterization of two novel hepcidins from orange-spotted grouper, Epinephelus coioides. 

Pubmed ID   21145974

Reference   Fish Shellfish Immunol. 2011 Feb;30(2):559-68. 

Author   Zhou JG, Wei JG, Xu D, Cui HC, Yan Y, Ou-Yang ZL, Huang XH, Huang YH, Qin QW.

DOI   10.1016/j.fsi.2010.11.021