General Information
DRAVP ID DRAVPe01553
Peptide Name EC-hepcidin2
Sequence MKTFSVAVAVAVVLAFICTQESSALPVTGIEELVEPVSSDNNDNHQGLPVELRERLVNIRKKRAPTDCIPYCYPTGDGFHCGVTCRF
Sequence Length 87
UniProt ID No entry found
Taxon ID None
Source Epinephelus coioides
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism SGIV
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01553
Linear/Cyclic Cyclic
N-terminal Modification Free
C-terminal Modification Free
Other Modification There are two pairs of disulfide bonds.
Stereochemistry L
Physicochemical Information
Formula C418H665N115O127S6
Absent amino acids W
Common amino acids V
Mass 9525.93
Pl 5.55
Basic residues 10
Acidic residues 10
Hydrophobic residues 31
Net charge 0
Boman Index -11678
Hydrophobicity 5.06
Aliphatic Index 88.39
Half Life
Extinction Coefficient cystines 3230
Absorbance 280nm 37.56
Polar residues 27
Literature Information
Literature 1
Title Molecular cloning and characterization of two novel hepcidins from orange-spotted grouper, Epinephelus coioides.
Pubmed ID 21145974
Reference Fish Shellfish Immunol. 2011 Feb;30(2):559-68.
Author Zhou JG, Wei JG, Xu D, Cui HC, Yan Y, Ou-Yang ZL, Huang XH, Huang YH, Qin QW.