DRAVP ID  DRAVPe01567

Peptide Name   Apelin-36

Sequence  LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF

Sequence Length  36

UniProt ID  Q9TUI9  A0A484GMR2  A0A5N3XG03  A0A2Y9M6A9  A0A5G2R3Z5  A0A2Y9SZ03  A0A2U4A1K6 

Source  Bos taurus (Bovine)

Target Organism  HIV

Assay  Reverse transcriptase assay

Activity 

• [Ref.10802050]HIV:Inhibition of HIV infection in NP-2/CD4/APJ cells(IC50=0.3 μg/ml).
• [Ref.11090199]HIV-1:inhibition of HIV-1 infection in CD4 APJ cells(IC50=7 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  APJ receptor

Mechanism  APJ receptor could help HIV virus enter the target cells. The peptide can bind with APJ receptor and block virus entry, thus inhibiting virus infection.

PDB ID  None

Predicted Structure Download  DRAVPe01567

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L

Literature 1

Title   Apelin peptides block the entry of human immunodeficiency virus (HIV).

Pubmed ID   10802050

Reference   FEBS Lett. 2000 May 4;473(1):15-8.

Author   Zou MX, Liu HY, Haraguchi Y, Soda Y, Tatemoto K, Hoshino H.

DOI   10.1016/s0014-5793(00)01487-3

Literature 2

Title   Apelin, the natural ligand of the orphan seven-transmembrane receptor APJ, inhibits human immunodeficiency virus type 1 entry.

Pubmed ID   11090199

Reference   J Virol. 2000 Dec;74(24):11972-6.

Author   Cayabyab M, Hinuma S, Farzan M, Choe H, Fukusumi S, Kitada C, Nishizawa N, Hosoya M, Nishimura O, Messele T, Pollakis G, Goudsmit J, Fujino M, Sodroski J.

DOI   10.1128/jvi.74.24.11972-11976.2000