General Information
DRAVP ID DRAVPe01567
Peptide Name Apelin-36
Sequence LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF
Sequence Length 36
UniProt ID Q9TUI9 A0A484GMR2 A0A5N3XG03 A0A2Y9M6A9 A0A5G2R3Z5 A0A2Y9SZ03 A0A2U4A1K6
Source Bos taurus (Bovine)
Activity Information
Target Organism HIV
Assay Reverse transcriptase assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target APJ receptor
Mechanism APJ receptor could help HIV virus enter the target cells. The peptide can bind with APJ receptor and block virus entry, thus inhibiting virus infection.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe01567
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C185H298N68O42S
Absent amino acids ACDEINTY
Common amino acids R
Mass 4178.89
Pl 12.85
Basic residues 11
Acidic residues 0
Hydrophobic residues 6
Net charge 11
Boman Index -12838
Hydrophobicity -150.83
Aliphatic Index 29.72
Half Life
Extinction Coefficient cystines 5500
Absorbance 280nm 157.14
Polar residues 8
Literature Information
Literature 1
Title Apelin peptides block the entry of human immunodeficiency virus (HIV).
Pubmed ID 10802050
Reference FEBS Lett. 2000 May 4;473(1):15-8.
Author Zou MX, Liu HY, Haraguchi Y, Soda Y, Tatemoto K, Hoshino H.
DOI 10.1016/s0014-5793(00)01487-3
Literature 2
Title Apelin, the natural ligand of the orphan seven-transmembrane receptor APJ, inhibits human immunodeficiency virus type 1 entry.
Pubmed ID 11090199
Reference J Virol. 2000 Dec;74(24):11972-6.
Author Cayabyab M, Hinuma S, Farzan M, Choe H, Fukusumi S, Kitada C, Nishizawa N, Hosoya M, Nishimura O, Messele T, Pollakis G, Goudsmit J, Fujino M, Sodroski J.