General Information


DRAVP ID  DRAVPe01567

Peptide Name   Apelin-36

Sequence  LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF

Sequence Length  36

UniProt ID  Q9TUI9  A0A484GMR2  A0A5N3XG03  A0A2Y9M6A9  A0A5G2R3Z5  A0A2Y9SZ03  A0A2U4A1K6 

Taxon ID  None

Source  Bos taurus (Bovine)

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HIV

Assay  Reverse transcriptase assay

Activity 

  • [Ref.10802050]HIV:Inhibition of HIV infection in NP-2/CD4/APJ cells(IC50=0.3 μg/ml).
  • [Ref.11090199]HIV-1:inhibition of HIV-1 infection in CD4 APJ cells(IC50=7 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  APJ receptor

Mechanism  APJ receptor could help HIV virus enter the target cells. The peptide can bind with APJ receptor and block virus entry, thus inhibiting virus infection.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe01567

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C185H298N68O42S

Absent amino acids  ACDEINTY

Common amino acids  R

Mass  4178.89

Pl  12.85

Basic residues  11

Acidic residues  0

Hydrophobic residues  6

Net charge  11

Boman Index  -12838

Hydrophobicity  -150.83

Aliphatic Index  29.72

Half Life 

  •     Mammalian:5.5 hour
  •     Yeast:3 min
  •     E.coli:2 min

Extinction Coefficient cystines  5500

Absorbance 280nm  157.14

Polar residues  8



Literature Information


Literature 1

Title   Apelin peptides block the entry of human immunodeficiency virus (HIV).

Pubmed ID   10802050

Reference   FEBS Lett. 2000 May 4;473(1):15-8.

Author   Zou MX, Liu HY, Haraguchi Y, Soda Y, Tatemoto K, Hoshino H.

DOI   10.1016/s0014-5793(00)01487-3

Literature 2

Title   Apelin, the natural ligand of the orphan seven-transmembrane receptor APJ, inhibits human immunodeficiency virus type 1 entry.

Pubmed ID   11090199

Reference   J Virol. 2000 Dec;74(24):11972-6.

Author   Cayabyab M, Hinuma S, Farzan M, Choe H, Fukusumi S, Kitada C, Nishizawa N, Hosoya M, Nishimura O, Messele T, Pollakis G, Goudsmit J, Fujino M, Sodroski J.

DOI   10.1128/jvi.74.24.11972-11976.2000