DRAVP ID  DRAVPe01602

Peptide Name   Rex (1-21) -RTD

Sequence  MPKTRRRPRRSQRKRPPTPWPYGRKKRRQRRR

Sequence Length  32

UniProt ID  P0C207  P04612 

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  HIV

Assay  MAGI assay

Activity 

• [Ref.20580677]HIV-1 IIIB:inhibition of virus replication in PM1-CCR5 cells(EC50=2.5±0.76 μM);
• HIV-1 Bal:inhibition of virus replication in PM1-CCR5 cells(EC50>10 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  Not found

Mechanism  Peptide derived from the RNA-binding domain of HIV-1 Rev can act as dual-target inhibitors that inhibit HIV-1 entry and viral production in the early and late phases of replication. 

PDB ID  None

Predicted Structure Download  DRAVPe01602

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L

Literature 1

Title   Rev-derived peptides inhibit HIV-1 replication by antagonism of Rev and a co-receptor, CXCR4.

Pubmed ID   20580677

Reference   Int J Biochem Cell Biol. 2010 Sep;42(9):1482-8.

Author   Shimane K, Kodama EN, Nakase I, Futaki S, Sakurai Y, Sakagami Y, Li X, Hattori T, Sarafianos SG, Matsuoka M.

DOI   10.1016/j.biocel.2010.05.005