General Information

General Information

DRAVP ID DRAVPe01602

Peptide Name Rex (1-21) -RTD

Sequence MPKTRRRPRRSQRKRPPTPWPYGRKKRRQRRR

Sequence Length 32

UniProt ID P0C207 P04612

Source Synthetic construct

Activity Information

Target Organism HIV

Assay MAGI assay

Activity

[Ref.20580677]HIV-1 IIIB:inhibition of virus replication in PM1-CCR5 cells(EC50=2.5±0.76 μM);
HIV-1 Bal:inhibition of virus replication in PM1-CCR5 cells(EC50>10 μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target Not found

Mechanism Peptide derived from the RNA-binding domain of HIV-1 Rev can act as dual-target inhibitors that inhibit HIV-1 entry and viral production in the early and late phases of replication.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe01602

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C180H314N78O39S

Absent amino acids ACDEFHILNV

Common amino acids R

Mass 4227.03

Pl 12.74

Basic residues 17

Acidic residues 0

Hydrophobic residues 1

Net charge 17

Boman Index -23030

Hydrophobicity -292.5

Aliphatic Index 0

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 6990

Absorbance 280nm 225.48

Polar residues 5

Literature Information

Literature 1

Title Rev-derived peptides inhibit HIV-1 replication by antagonism of Rev and a co-receptor, CXCR4.

Pubmed ID 20580677

Reference Int J Biochem Cell Biol. 2010 Sep;42(9):1482-8.

Author Shimane K, Kodama EN, Nakase I, Futaki S, Sakurai Y, Sakagami Y, Li X, Hattori T, Sarafianos SG, Matsuoka M.

DOI 10.1016/j.biocel.2010.05.005