To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe01631
Peptide Name P5(ACE2 (4-39))
Sequence EEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEE
Sequence Length 36
UniProt ID Q9BYF1
Source Synthetic construct(derived from angiotensin-converting enzyme 2)
Activity Information
Target Organism SARS-CoV
Assay Pseudovirus infection assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target spike glycoprotein
Mechanism Virus entry into cells is mediated through interactions between spike (S) glycoprotein and angiotensin-converting enzyme 2 (ACE2), peptide derived from ACE2 could bind with spike glycoprotein and inhibits virus entry.
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C192H275N47O67
Absent amino acids CGMPRV
Common amino acids E
Mass 4313.57
Pl 4.16
Basic residues 3
Acidic residues 8
Hydrophobic residues 11
Net charge -5
Boman Index -9351
Hydrophobicity -106.39
Aliphatic Index 51.67
Half Life
Extinction Coefficient cystines 8480
Absorbance 280nm 242.29
Polar residues 12
Literature Information
Literature 1
Title Identification of critical determinants on ACE2 for SARS-CoV entry and development of a potent entry inhibitor.
Pubmed ID 16510163
Reference Virology. 2006 Jun 20;350(1):15-25.
Author Han DP, Penn-Nicholson A, Cho MW.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.