General Information

General Information

DRAVP ID DRAVPe01713

Peptide Name HKU4-HR2P2

Sequence EISKINTTLLDLSDEMAMLLQEVVKQLNDSYIDLKEL

Sequence Length 37

UniProt ID No entry found

Taxon ID None

Source Synthetic construct

Validation Experimentally Validated

Origin Information

Gene Name/ID Not Available

GenBank Not Available

Amino Acid position Not Available

Domain Accession ID Not Available

Nucleotide sequence ID Not Available

Molecular Type Not Available

Chromosomal Position Not Available

Activity Information

Target Organism MERS-CoV

Assay Cell–Cell Fusion Assay

Activity

[Ref.30646495]MERS-CoV:inhibition of cell-cell fusion between 293T cells and Huh-7 cells(IC50=0.38 μM);
MERS-CoV Q1020:inhibition of Pseudovirus Infection in Huh-7 cells(IC50=0.34 μM);
MERS-CoV Q1020H:inhibition of Pseudovirus Infection in Huh-7 cells(IC50=0.44 μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.30646495]No cytotoxicity against Huh-7 cells up to 100 μM.

Binding Target membrane

Mechanism The peptide bind with HR1 of MERS-CoV and thus disrupting the process of MERS-6HB formation can inhibit virus–cell membrane fusion and abolish viral infection.

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C187H314N44O64S2

Absent amino acids CFGHPRW

Common amino acids L

Mass 4266.93

Pl 4.07

Basic residues 3

Acidic residues 8

Hydrophobic residues 14

Net charge -5

Boman Index -4990

Hydrophobicity -2.43

Aliphatic Index 134.32

Half Life

Mammalian:1 hour
Yeast:30 min
E.coli:>10 hour

Extinction Coefficient cystines 1490

Absorbance 280nm 41.39

Polar residues 8

Literature Information

Literature 1

Title Potent MERS-CoV Fusion Inhibitory Peptides Identified from HR2 Domain in Spike Protein of Bat Coronavirus HKU4.

Pubmed ID 30646495

Reference Viruses. 2019 Jan 14;11(1):56. doi: 10.3390/v11010056

Author Xia S, Lan Q, Pu J, Wang C, Liu Z, Xu W, Wang Q, Liu H, Jiang S, Lu L.

DOI 10.3390/v11010056