General Information

General Information

DRAVP ID DRAVPe01713

Peptide Name HKU4-HR2P2

Sequence EISKINTTLLDLSDEMAMLLQEVVKQLNDSYIDLKEL

Sequence Length 37

UniProt ID No entry found

Source Synthetic construct

Activity Information

Target Organism MERS-CoV

Assay Cell–Cell Fusion Assay

Activity

[Ref.30646495]MERS-CoV:inhibition of cell-cell fusion between 293T cells and Huh-7 cells(IC50=0.38 μM);
MERS-CoV Q1020:inhibition of Pseudovirus Infection in Huh-7 cells(IC50=0.34 μM);
MERS-CoV Q1020H:inhibition of Pseudovirus Infection in Huh-7 cells(IC50=0.44 μM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.30646495]No cytotoxicity against Huh-7 cells up to 100 μM.

Binding Target membrane

Mechanism The peptide bind with HR1 of MERS-CoV and thus disrupting the process of MERS-6HB formation can inhibit virus–cell membrane fusion and abolish viral infection.

Structure Information

PDB ID None

Predicted Structure Download No predicted structure available

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C187H314N44O64S2

Absent amino acids CFGHPRW

Common amino acids L

Mass 4266.93

Pl 4.07

Basic residues 3

Acidic residues 8

Hydrophobic residues 14

Net charge -5

Boman Index -4990

Hydrophobicity -2.43

Aliphatic Index 134.32

Half Life

Mammalian:1 hour
Yeast:30 min
E.coli:>10 hour

Extinction Coefficient cystines 1490

Absorbance 280nm 41.39

Polar residues 8

Literature Information

Literature 1

Title Potent MERS-CoV Fusion Inhibitory Peptides Identified from HR2 Domain in Spike Protein of Bat Coronavirus HKU4.

Pubmed ID 30646495

Reference Viruses. 2019 Jan 14;11(1):56. doi: 10.3390/v11010056

Author Xia S, Lan Q, Pu J, Wang C, Liu Z, Xu W, Wang Q, Liu H, Jiang S, Lu L.

DOI 10.3390/v11010056