General Information


DRAVP ID  DRAVPe01715

Peptide Name   MERS-HR2P

Sequence  GGGSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL

Sequence Length  39

UniProt ID  No entry found

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  MERS-CoV

Assay  Cell–Cell Fusion Assay

Activity 

  • [Ref.30646495]MERS-CoV:inhibition of cell-cell fusion between 293T cells and Huh-7 cells(IC50=1.07 μM);
  • MERS-CoV Q1020:inhibition of Pseudovirus Infection in Huh-7 cells(IC50=1.14 μM);
  • MERS-CoV Q1020H:inhibition of Pseudovirus Infection in Huh-7 cells(IC50=1.71 μM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.30646495]No cytotoxicity against Huh-7 cells up to 100 μM.

Binding Target  membrane

Mechanism  The peptide bind with HR1 of MERS-CoV and thus disrupting the process of MERS-6HB formation can inhibit virus–cell membrane fusion and abolish viral infection.



Structure Information


PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C191H316N46O64S

Absent amino acids  CFHPRW

Common amino acids  L

Mass  4312.94

Pl  4.18

Basic residues  2

Acidic residues  5

Hydrophobic residues  14

Net charge  -3

Boman Index  -3045

Hydrophobicity  8.97

Aliphatic Index  127.44

Half Life 

  •     Mammalian:30 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  2980

Absorbance 280nm  78.42

Polar residues  14



Literature Information


Literature 1

Title   Potent MERS-CoV Fusion Inhibitory Peptides Identified from HR2 Domain in Spike Protein of Bat Coronavirus HKU4.

Pubmed ID   30646495

Reference   Viruses. 2019 Jan 14;11(1):56. doi: 10.3390/v11010056

Author   Xia S, Lan Q, Pu J, Wang C, Liu Z, Xu W, Wang Q, Liu H, Jiang S, Lu L.

DOI   10.3390/v11010056