General Information
DRAVP ID DRAVPe01737
Peptide Name SARS-CoV (1130-1189)[F1P]
Sequence PKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYE
Sequence Length 60
UniProt ID P59594
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism SARS-CoV, MHV
Assay Infection inhibition assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism Inhibits virus infection by interfering with six-helix bundle formation(fusion inhibitor).
Structure Information
PDB ID None
Predicted Structure Download No predicted structure available
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C298H479N79O102
Absent amino acids CMW
Common amino acids ELDKN
Mass 6800.55
Pl 4.49
Basic residues 8
Acidic residues 13
Hydrophobic residues 19
Net charge -5
Boman Index -13562
Hydrophobicity -72
Aliphatic Index 100.67
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 50.51
Polar residues 16
Literature Information
Literature 1
Title Severe acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.
Pubmed ID 15150417
Reference Proc Natl Acad Sci U S A. 2004 Jun 1;101(22):8455-60.
Author Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.